Recombinant Salmonella typhimurium 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Ubiquinone Biosynthesis

UbiA operates in the early steps of Q8 synthesis:

  • Catalytic Activity: Transfers a C40 octaprenyl chain from octaprenyl pyrophosphate to 4-hydroxybenzoate .

  • Essential for Aerobic Respiration: Q8 is required for electron transport in oxidative phosphorylation. ubiA deletion mutants lack Q8, forcing reliance on anaerobic respiration via menaquinones (MK/DMK) .

  • Phenotypic Consequences: ubiA mutants exhibit impaired motility, reduced growth in rich media, and sensitivity to oxidative stress .

Suppressor Mutations in Respiratory Enzymes

In ubiA deletion strains, spontaneous suppressor mutations in NADH:quinone oxidoreductase-1 (Nuo complex) partially restore electron transport :

Suppressor MutationLocationFunctional Impact
nuoG (Q297K)Hydrophilic domainRestores NADH→DMK/MK electron transfer efficiency
nuoM (A254S)Membrane domainEnhances enzyme stability
nuoN (A444E)Membrane domainImproves quinone binding affinity

These mutations increase Nuo complex abundance and activity, compensating for Q8 deficiency by enhancing electron flow to alternative quinones (DMK/MK) .

Virulence and Intracellular Survival

  • Macrophage Proliferation: ubiA mutants fail to proliferate intracellularly due to Q8-dependent aerobic respiration requirements .

  • Oxidative Stress Sensitivity: Q8 deficiency reduces antioxidant capacity, increasing susceptibility to host-derived reactive oxygen species (ROS) .

Recombinant UbiA in Biomedical Applications

Recombinant UbiA serves as a tool for:

  • Enzyme Kinetics Studies: Characterizing polyprenyltransferase mechanisms .

  • Vaccine Development: Investigating Q8 biosynthesis as a target for attenuated Salmonella strains .

  • Metabolic Engineering: Optimizing quinone pathways in synthetic biology .

Key Challenges and Future Directions

  • Structural Insights: The crystal structure of UbiA remains unresolved, limiting mechanistic studies .

  • Therapeutic Potential: Q8 biosynthesis inhibitors could target Salmonella infections, but off-target effects on human CoQ10 synthesis must be avoided .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
ubiA; STM4234; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
ubiA
Target Protein Sequence
MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLNAMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGWGYY WAVLVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the initial membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links

KEGG: stm:STM4234

STRING: 99287.STM4234

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of 4-hydroxybenzoate octaprenyltransferase (ubiA) in Salmonella typhimurium?

4-hydroxybenzoate octaprenyltransferase (ubiA) plays a critical role in ubiquinone (coenzyme Q) biosynthesis in Salmonella typhimurium. This enzyme catalyzes the prenylation of 4-hydroxybenzoate, an essential step in the electron transport chain that supports bacterial energy metabolism. As a membrane-bound enzyme, ubiA contributes significantly to bacterial survival under various environmental conditions by enabling efficient energy production .

How does the structure of ubiA relate to its function in Salmonella typhimurium?

The ubiA protein contains multiple transmembrane domains that anchor it within the cytoplasmic membrane, with active sites accessible to both cytoplasmic substrates and membrane-embedded prenyl donors. This unique structural arrangement allows the enzyme to facilitate the transfer of hydrophobic prenyl groups to hydrophilic 4-hydroxybenzoate substrates. Researchers investigating the structure-function relationship typically employ site-directed mutagenesis of conserved residues followed by complementation assays to assess functional impacts of structural modifications .

What expression systems are most effective for producing recombinant Salmonella typhimurium ubiA?

For laboratory-scale production of recombinant Salmonella typhimurium ubiA, several expression systems have proven effective:

Expression SystemAdvantagesLimitationsTypical Yield
pBAD/araCTight regulation of expressionModerate protein yields0.5-2 mg/L culture
pET systemHigh expression levelsPotential for inclusion bodies2-5 mg/L culture
pCZ1 Asd+ plasmid systemStable expression without antibiotic selectionRequires Δasd host strain1-3 mg/L culture

The pET system generally offers the highest yield but may require optimization of induction conditions to minimize inclusion body formation. The pCZ1 Asd+ plasmid system, similar to that used for O-antigen expression, provides balanced expression with good stability in the absence of antibiotic selection pressure .

What considerations are critical when designing experiments to study recombinant ubiA expression?

When designing experiments to study recombinant ubiA expression in Salmonella typhimurium, researchers should prioritize:

  • Variable control: Identify and control all independent variables (expression vector, host strain, induction conditions) and dependent variables (enzyme activity, protein yield, bacterial fitness) .

  • Strain selection: Consider using defined mutants such as SLT11 (ΔrfbP), SLT12 (ΔrmlB-rfbP) or similar construction approaches to provide clean genetic backgrounds .

  • Validation methods: Implement multiple validation techniques for ubiA expression and activity, including Western blotting, enzyme activity assays, and complementation of ubiA-deficient strains.

  • Randomization: Ensure proper randomization in experimental designs to minimize the impact of uncontrolled variables .

  • Statistical power: Calculate sample sizes needed to detect meaningful differences in enzyme activity or bacterial phenotypes with appropriate statistical power.

Following these principles helps establish clear cause-effect relationships between experimental manipulations and observed outcomes .

How should researchers optimize the purification protocol for recombinant Salmonella typhimurium ubiA?

The purification of membrane-bound ubiA presents specific challenges due to its hydrophobic nature. A methodological approach includes:

  • Membrane fraction isolation: Disrupt cells via sonication or French press, followed by differential centrifugation to isolate membrane fractions.

  • Detergent screening: Test multiple detergents for solubilization efficacy:

DetergentConcentration RangeAdvantagesLimitations
n-Dodecyl-β-D-maltoside (DDM)0.5-2%Mild, preserves activityModerate efficiency
Triton X-1000.5-2%Good solubilizationPotential activity loss
Digitonin0.5-1%Excellent for activity retentionExpensive, variable purity
  • Affinity chromatography: Employ His-tag or other affinity tags positioned to minimize interference with enzyme function.

  • Activity validation: Assess enzyme activity at each purification step using 4-hydroxybenzoate and prenyl donor substrates, monitoring product formation via HPLC or LC-MS.

Each purification step should be validated through SDS-PAGE and Western blotting to confirm protein identity and purity .

How can ubiA be utilized in recombinant attenuated Salmonella vaccine development?

Recombinant attenuated Salmonella typhimurium strains expressing modified ubiA can serve as versatile platforms for vaccine development through several mechanisms:

  • Metabolic burden attenuation: Controlled overexpression of ubiA can create metabolic burden, contributing to bacterial attenuation while maintaining immunogenicity.

  • Antigen co-expression: ubiA expression can be coupled with heterologous antigen delivery systems using similar plasmid constructs to those employed for O-antigen expression.

  • Adjuvant effects: The ubiquinone biosynthesis pathway modulation can influence bacterial membrane properties, potentially enhancing immune recognition.

Research approaches would parallel those used for other Salmonella-based vaccines, including introduction of crp and cya gene mutations for attenuation, followed by immunogenicity and protective efficacy assessment in appropriate animal models such as BALB/c mice .

What advanced techniques can address challenges in analyzing ubiA structure-function relationships?

Several sophisticated approaches can overcome challenges in studying the membrane-bound ubiA:

  • Cryo-electron microscopy: For structural studies of ubiA in native-like lipid environments.

  • Nanodiscs technology: Incorporation of purified ubiA into nanodiscs provides a stable, defined membrane mimetic for functional studies.

  • Single-molecule FRET: To analyze conformational changes during catalysis.

  • Computational modeling: Molecular dynamics simulations can predict substrate binding modes and conformational changes, guiding experimental design.

  • Synthetic biology approaches: The construction of chimeric enzymes combining domains from different prenyl transferases to identify functional modules.

These techniques must be integrated with traditional biochemical methods for comprehensive understanding of ubiA function .

How should researchers approach discrepancies in ubiA activity data between in vitro and in vivo experiments?

When confronting discrepancies between in vitro enzyme assays and in vivo phenotypic observations, researchers should implement a systematic troubleshooting approach:

  • Validation of in vitro conditions: Examine whether in vitro reaction conditions (pH, ionic strength, detergent concentrations) accurately mimic the native membrane environment.

  • Substrate availability assessment: Quantify intracellular concentrations of 4-hydroxybenzoate and prenyl donors using metabolomics approaches.

  • Protein-protein interaction analysis: Investigate potential interactions between ubiA and other components of the ubiquinone biosynthesis pathway.

  • Controlled variable examination: Design experiments that systematically test each variable independently:

VariableIn Vitro Control MethodIn Vivo Validation Approach
Substrate concentrationDefined amounts in reaction bufferMetabolic labeling with isotope tracers
Enzyme concentrationQuantified purified proteinControlled expression from inducible promoters
Membrane environmentDefined lipid compositionLipidomic analysis of bacterial membranes
  • Statistical analysis: Apply appropriate statistical methods to determine if observed differences are significant or within expected experimental variation .

What experimental design approaches best address potential confounding variables in ubiA functional studies?

To minimize the impact of confounding variables in ubiA studies, implement these experimental design strategies:

  • Factorial designs: Use full or fractional factorial designs to systematically evaluate the effects of multiple variables simultaneously. For example, a 2³ factorial design examining temperature, pH, and detergent concentration on ubiA activity provides insight into main effects and interactions.

  • Blocking designs: Group experimental units into blocks based on known sources of variation (e.g., different batches of reagents or different days of experimentation).

  • Repeated measures designs: When evaluating ubiA activity over time or across conditions, use repeated measures designs to account for within-subject correlations.

  • Control of extraneous variables: Identify and control variables that might influence ubiA function:

    • Growth phase of bacteria

    • Oxygen availability

    • Medium composition

    • Genetic background of host strains

  • Randomization: Employ proper randomization techniques to minimize systematic biases in experimental execution and analysis .

What strategies help overcome low expression levels of functional recombinant Salmonella typhimurium ubiA?

When facing challenges with low expression levels of functional ubiA, consider this methodological approach:

  • Codon optimization: Adjust the coding sequence based on Salmonella typhimurium codon usage patterns.

  • Expression vector selection: Test multiple promoter strengths and induction systems:

Promoter SystemStrengthInduction MethodBest Application
T7Very strongIPTGMaximum yield, toxicity concerns
araBADTitratableArabinoseFine-tuned expression control
lacUV5ModerateIPTGBalanced expression
TetAVariableAnhydrotetracyclineLow background, tight control
  • Host strain engineering: Use strains with enhanced membrane protein expression capacity or chaperon co-expression.

  • Expression conditions optimization: Systematically test:

    • Induction timing (early vs. mid vs. late log phase)

    • Induction temperature (16°C, 25°C, 30°C, 37°C)

    • Media composition (minimal vs. rich, supplementation with membrane components)

  • Fusion tag strategies: Test various fusion partners that can enhance folding and membrane integration while maintaining function .

How can researchers effectively analyze the impact of ubiA mutations on Salmonella virulence and survival?

To comprehensively assess the effects of ubiA mutations on Salmonella virulence and survival, employ a multi-faceted approach:

  • In vitro phenotypic assays:

    • Swimming motility assays in semi-solid agar

    • Sensitivity testing to antimicrobial compounds (polymyxin B, sodium deoxycholate)

    • Growth curve analysis under various stress conditions

  • Ex vivo survival models:

    • Macrophage infection models measuring bacterial persistence

    • Serum resistance assays

  • In vivo colonization studies:

    • Competitive index assays comparing wild-type and mutant strains

    • Tissue distribution studies following oral or intraperitoneal infection

    • Time-course experiments measuring bacterial burden in specific tissues

  • Molecular analysis:

    • Transcriptomic analysis comparing wild-type and ubiA mutants

    • Metabolomic profiling focusing on ubiquinone and related metabolites

    • Membrane integrity assessments using fluorescent dyes

  • Statistical analysis:

    • Apply appropriate statistical tests (t-tests, ANOVA, survival analysis)

    • Consider using mixed-effects models for time-course experiments

    • Calculate competitive indices with confidence intervals for in vivo studies .

What emerging technologies might advance our understanding of ubiA function in Salmonella typhimurium?

Several cutting-edge technologies show promise for deepening our understanding of ubiA function:

  • CRISPR interference (CRISPRi): For precise modulation of ubiA expression levels without permanent genetic modification.

  • Proximity-dependent biotin identification (BioID): To identify protein interaction partners of ubiA in native membrane environments.

  • Native mass spectrometry: For analysis of intact membrane protein complexes involving ubiA.

  • Microfluidic devices: To study single-cell variations in ubiA expression and activity.

  • Artificial intelligence approaches: For predicting structure-function relationships and guiding protein engineering efforts.

  • In situ cryo-electron tomography: To visualize ubiA distribution and organization within bacterial membranes at near-atomic resolution .

How might integrating ubiA studies with systems biology approaches enhance vaccine development?

Integrating ubiA research with systems biology can create synergistic benefits for vaccine development through:

  • Metabolic modeling: Developing comprehensive models of ubiquinone biosynthesis to predict optimal attenuation strategies.

  • Transcriptomic and proteomic integration: Identifying regulatory networks affected by ubiA manipulation that influence immunogenicity.

  • Host-pathogen interaction mapping: Characterizing how ubiA-mediated changes in bacterial physiology affect host immune recognition.

  • Predictive vaccine platforms: Using machine learning to predict optimal combinations of ubiA modifications and heterologous antigen expression.

  • Personalized vaccine approaches: Developing tailored Salmonella-based vaccines for different population groups based on immunological profiles.

This integrated approach could significantly accelerate the rational design of recombinant attenuated Salmonella vaccines with enhanced safety and efficacy profiles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.