Recombinant Salmonella typhimurium ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

The atpB subunit is essential for:

  • ATP Synthesis: Coupling proton motive force to ATP production via the F₁F₀ ATP synthase .

  • Proton Translocation: Facilitating H⁺ flow across the cytoplasmic membrane to maintain pH homeostasis .

  • Acid Tolerance: Enabling Salmonella survival under acidic conditions (e.g., phagosomal pH <4.5) .

Acid Resistance Data :

StrainSurvival at pH 3.3 (60 min)Adaptation at pH 5.6
Wild-type6%Enhanced survival
atpB mutant1%No adaptation
atpH mutant0%No adaptation

Molecular Interactions and Regulatory Mechanisms

atpB interacts with virulence-associated proteins to modulate bacterial fitness:

A. MgtC Binding

  • Interaction: MgtC binds atpB to inhibit F₁F₀ ATP synthase activity, reducing ATP overproduction and stabilizing cytoplasmic pH during macrophage infection .

  • Consequence: mgtC mutants exhibit elevated ATP levels (~2.5-fold higher than wild-type) , leading to growth defects in low Mg²⁺ environments .

B. CigR-Mediated Regulation

  • The chaperone protein CigR competes with atpB for MgtC binding, modulating ATP synthase activity and virulence gene expression .

A. Attenuation in Serovars

Mutations in atpB significantly reduce virulence across Salmonella serovars:

  • Typhimurium: 100-fold attenuation in mice .

  • Gallinarum/Dublin: Loss of persistence in avian and murine hosts .

B. Intracellular Survival Defects

  • Macrophage Persistence: atpB mutants show 10–100-fold lower survival in J774A.1 macrophages compared to wild-type strains .

  • Invasion Efficiency: Reduced colonization of spleen and liver in chickens .

A. Attenuated Strains

  • Vaccine Design: atpB mutants are used in live-attenuated Salmonella vaccines due to their safety profile and immunogenicity .

  • Immune Response: Triggers Th1-dominant immunity against heterologous antigens (e.g., pneumococcal PspA) .

B. Key Vaccine Attributes :

  • Safety: No recovery from liver/spleen 10 days post-infection in chickens .

  • Efficacy: Protects against lethal challenges (e.g., 60% survival in Streptococcus pneumoniae models) .

Research Implications and Future Directions

  • Drug Targeting: atpB’s role in pH regulation makes it a candidate for novel antimicrobials .

  • Synthetic Biology: Engineered atpB variants could optimize ATP flux for industrial protein production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; STM3871; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
atpB
Target Protein Sequence
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMF RSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: stm:STM3871

STRING: 99287.STM3871

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase and what role does the atpB subunit play in Salmonella typhimurium?

ATP synthase is a universal enzyme that synthesizes ATP from ADP and phosphate using the energy stored in transmembrane ion gradients. In Salmonella and other bacteria, ATP synthase has an F-type architecture consisting of two main subcomplexes: the membrane-embedded F0 portion and the catalytic F1 portion . The beta subunit (atpB) is a critical component of the F1 subcomplex that houses the catalytic sites for ATP synthesis. This subunit is highly conserved across species, making it a valuable target for both fundamental research and potential therapeutic applications.

How does the structure of bacterial ATP synthase compare to mitochondrial and chloroplastic forms?

ATP Synthase SourceF1 SubunitsF0 SubunitsKey Distinguishing Features
Bacterial (S. typhimurium)α3β3γδεab2c8-15Simpler structure, directly linked to plasma membrane
Mitochondrialα3β3γδεa, b, c8-15, plus additional subunitsAdditional regulatory subunits, more complex assembly
Chloroplasticα3β3γδεa, b, b', c14, plus additional subunitsSpecialized for function during photosynthesis

What are the most effective methods for detecting and quantifying atpB in Salmonella research?

Several validated approaches can be employed for atpB detection and quantification:

  • Immunological techniques: Western blot analysis using specific anti-atpB antibodies is highly effective. Polyclonal antibodies like the chicken anti-AtpB antibody have been validated for detecting bacterial F-type ATP synthases with recommended dilutions of 1:5000-1:8000 for Western blot applications .

  • Immunolocalization: For subcellular localization studies, immunogold techniques can be employed with dilutions around 1:500 . These approaches allow for precise localization of atpB within bacterial cells.

  • Mass spectrometry: For absolute quantification, targeted MS approaches like selected reaction monitoring (SRM) can be used with synthetic peptide standards derived from atpB sequences.

  • Recombinant expression systems: Expressing tagged versions of atpB allows for easier detection and quantification through affinity methods.

How can I optimize antibody-based detection of Salmonella atpB?

For optimal immunodetection of Salmonella atpB:

  • Antibody selection: Use well-characterized antibodies with demonstrated reactivity to bacterial ATP synthase. The chicken polyclonal antibody against atpB has been validated for detecting F-type ATP synthases from both plants and bacteria .

  • Sample preparation considerations:

    • For membrane proteins like atpB, proper solubilization using appropriate detergents is critical

    • Heat denaturation should be carefully controlled to prevent aggregation

    • Reducing agents should be included to break disulfide bonds

  • Optimization parameters:

    • For Western blotting, dilutions between 1:5000-1:8000 are generally effective

    • For immunolocalization techniques, dilutions around 1:500 are recommended

    • Always prepare fresh antibody dilutions and avoid repeated freeze-thaw cycles

  • Control strategies:

    • Include purified recombinant atpB as a positive control

    • Use atpB knockout strains as negative controls

    • Consider using quantitation standards for semi-quantitative analysis

What expression systems are most suitable for producing recombinant Salmonella atpB?

The choice of expression system for Salmonella atpB depends on research goals:

  • E. coli expression systems: Most commonly used due to close phylogenetic relationship with Salmonella.

    • BL21(DE3) strains are suitable for cytoplasmic expression

    • C41/C43(DE3) strains are specialized for membrane protein expression

    • pET or pBAD vector systems provide controlled expression

  • Cell-free expression systems: Useful for avoiding toxicity issues.

    • Wheat germ extracts or E. coli lysates can be effective

    • Allow for direct incorporation of labeled amino acids for structural studies

  • Homologous expression: Expression within Salmonella itself.

    • Most likely to yield properly folded, functional protein

    • Useful for complementation studies in atpB mutants

    • Can be achieved using inducible promoter systems

What purification strategy should I employ for recombinant Salmonella atpB?

A multi-step purification approach is recommended:

  • Initial extraction:

    • For membrane-associated atpB, gentle cell disruption methods like sonication or French press

    • Membrane fraction isolation via ultracentrifugation

    • Detergent solubilization (DDM, LDAO, or Triton X-100)

  • Affinity chromatography:

    • His-tag purification using IMAC if a tag has been incorporated

    • Anti-atpB immunoaffinity chromatography using validated antibodies

  • Secondary purification:

    • Ion exchange chromatography based on atpB's calculated pI

    • Size exclusion chromatography for final polishing and buffer exchange

  • Quality control:

    • SDS-PAGE and Western blotting with specific antibodies

    • Circular dichroism to verify secondary structure

    • Mass spectrometry for identity confirmation

How can I measure the enzymatic activity of recombinant Salmonella atpB?

While isolated atpB typically requires the complete ATP synthase complex for full activity, several approaches can assess functionality:

  • Reconstitution studies:

    • Incorporation of purified atpB into ATP synthase subcomplexes

    • Liposome reconstitution with complete or partial ATP synthase assemblies

    • Measurement of ATP synthesis using established luminescence-based assays

  • Binding studies:

    • Nucleotide binding assays (fluorescent ATP analogs)

    • Interaction studies with other ATP synthase subunits

    • Structural changes upon nucleotide binding (monitored by circular dichroism)

  • Complementation assays:

    • Expression of recombinant atpB in atpB-deficient strains

    • Assessment of restored ATP synthesis capacity

    • Growth recovery under conditions requiring ATP synthase function

What approaches can I use to investigate the role of atpB in bacterial aggregation and biofilm formation?

Recent research has highlighted connections between bacterial surface components and aggregation behaviors:

  • Aggregation assays:

    • Quantitative assessment of bacterial clumping in the presence of antibodies or other agents

    • The table below shows representative aggregation percentages for different antibody concentrations :

Antibody Concentration (μg/mL)Percent Aggregation (Mean ± SD)
210.30 ± 2.78
2023.39 ± 7.85
20066.38 ± 4.98
  • Biofilm quantification:

    • Crystal violet staining to quantify biofilm formation

    • Comparison of wild-type and atpB mutant strains

    • Analysis of extracellular matrix components like cellulose

  • Microscopy techniques:

    • Fluorescence microscopy of labeled bacteria to visualize aggregation patterns

    • Scanning electron microscopy to examine biofilm ultrastructure

    • Confocal microscopy for three-dimensional biofilm architecture

How can atpB be utilized as a target for antibacterial development against Salmonella?

The essential nature of ATP synthase makes atpB a potential antibacterial target:

  • Inhibitor screening approaches:

    • High-throughput screening against purified atpB or ATP synthase complexes

    • Fragment-based drug discovery targeting specific binding sites

    • Structure-based virtual screening using resolved ATP synthase structures

  • Antibody-based strategies:

    • Development of antibodies targeting surface-exposed regions of atpB

    • Investigation of antibody-mediated aggregation effects similar to those observed with secretory IgA against Salmonella

    • Assessment of synergistic effects with conventional antibiotics

  • Vaccine development:

    • Evaluation of atpB as a potential vaccine antigen

    • Construction of attenuated strains with modified atpB function

    • Investigation of protective immunity against Salmonella infection

What role does atpB play in Salmonella pathogenesis and host-pathogen interactions?

ATP synthase components, including atpB, contribute to pathogenesis in several ways:

  • Energy provision for virulence:

    • ATP production to power type III secretion systems

    • Support for bacterial replication within host cells

    • Energy for flagellar motility and chemotaxis

  • Immune response interactions:

    • Potential recognition of bacterial ATP synthase components by host immune system

    • Antibody-mediated aggregation effects that can reduce tissue invasion

    • Induced extracellular matrix production that may protect against host defenses

  • Adaptation to host environments:

    • Role in acid tolerance response

    • Contribution to survival in nutrient-limited intracellular environments

    • Potential moonlighting functions beyond ATP synthesis

What structural information is available for Salmonella atpB and how can it guide research design?

Structural insights into bacterial ATP synthase beta subunits can inform experimental approaches:

  • Available structural data:

    • Crystal structures of F1 portions from related bacteria

    • Cryo-EM structures of complete ATP synthase complexes

    • Conservation analysis indicating functional domains

  • Structure-function relationship studies:

    • Mapping of catalytic sites and nucleotide binding regions

    • Identification of interface residues for interaction with other subunits

    • Conservation analysis across species to identify critical residues

  • Application to experimental design:

    • Rational design of mutations to probe specific functions

    • Selection of regions for antibody generation

    • Identification of potential drug binding sites

How can genetic manipulation approaches be used to study atpB function in Salmonella?

Various genetic strategies can illuminate atpB functions:

  • Gene knockout and complementation:

    • Construction of conditional atpB mutants (since complete deletion may be lethal)

    • Complementation with wild-type or mutated atpB variants

    • Phenotypic characterization under different growth conditions

  • Site-directed mutagenesis:

    • Targeted modification of catalytic residues

    • Alteration of interface regions for subunit interaction studies

    • Introduction of reporter tags for localization studies

  • Promoter manipulation:

    • Construction of strains with controlled expression levels

    • Analysis of effects of atpB overexpression or underexpression

    • Investigation of regulatory mechanisms controlling ATP synthase expression

How does atpB research intersect with studies on bacterial extracellular matrix formation?

Recent findings have uncovered interesting connections between ATP synthase and bacterial extracellular matrices:

  • Cellulose production relationship:

    • Antibody binding to surface antigens can trigger cellulose-dependent extracellular matrix formation in Salmonella

    • Mutants deficient in cellulose production genes (bcsA, bcsE) show reduced matrix formation upon antibody treatment

    • The relationship between ATP metabolism and cellulose production regulation

  • Methodology for studying these connections:

    • Crystal violet assays to quantify extracellular matrix production

    • Genetic studies using cellulose production mutants

    • Microscopy techniques to visualize matrix architecture

  • Implications for bacterial survival:

    • Potential protective effects of extracellular matrix against host defenses

    • Role in bacterial aggregation and biofilm formation

    • Influence on antibiotic susceptibility and environmental persistence

What are the emerging technologies that might advance atpB research in Salmonella?

Several cutting-edge approaches show promise for future atpB studies:

  • CRISPR-Cas9 applications:

    • Precise genome editing for subtle mutations in atpB

    • CRISPRi for controlled gene expression modulation

    • High-throughput screening of genetic interactions

  • Advanced imaging techniques:

    • Super-resolution microscopy for precise localization

    • Single-molecule tracking of ATP synthase components

    • Correlative light and electron microscopy for structural-functional studies

  • Systems biology approaches:

    • Metabolic flux analysis to determine ATP synthase contribution to energy metabolism

    • Integration of proteomics, transcriptomics, and metabolomics data

    • Computational modeling of ATP synthase function in whole-cell contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.