Recombinant Salmonella typhimurium Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
clsA; cls; STM1739; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
clsA
Target Protein Sequence
MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAQENSSVASSLFKLCERRQGIAGVKGNQ LQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSM NMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTATYAAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSLLVGWASRAFFSELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDTGFGADLAAVQDDYISRSRLLDARLWVKRPLWQRITERLFY FFSPLL
Uniprot No.

Target Background

Function

Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links

KEGG: stm:STM1739

STRING: 99287.STM1739

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase and why is it significant in Salmonella typhimurium research?

Cardiolipin synthase (cls) refers to enzymes responsible for synthesizing cardiolipin (CL), an acidic glycerophospholipid found in bacterial membranes. In Salmonella typhimurium, cardiolipin is a component of the outer membrane (OM) that undergoes regulation during infection. The enzymes are significant because S. Typhimurium regulates CL levels within the OM during host infection, potentially influencing host inflammatory responses. Cardiolipin's structural contribution to membrane stability and function makes it an important area of research for understanding bacterial adaptation to environmental stresses, particularly during infection processes .

How many cardiolipin synthase genes does S. typhimurium possess and what are their roles?

S. typhimurium possesses three distinct cardiolipin synthase genes:

  • ClsA (cls): Functions as the primary cardiolipin synthase during logarithmic growth phase

  • ClsB (ybhO): Contributes to cardiolipin production primarily during stationary phase

  • ClsC (ymdC): Also contributes to cardiolipin production during stationary phase

These enzymes catalyze slightly different reactions: ClsA and ClsB condense two phosphatidylglycerol molecules, while ClsC condenses phosphatidylglycerol and phosphatidylethanolamine molecules to produce cardiolipin . The varied contribution of each enzyme depending on growth phase suggests differential regulation and potentially specialized functions during different bacterial life cycle stages.

What happens to cardiolipin levels when individual cls genes are deleted in S. typhimurium?

  • ΔclsA mutants: Show significantly diminished cardiolipin levels during logarithmic growth phase, with ClsA being identified as the predominant synthase

  • ΔclsB or ΔclsC single mutants: Show minimal impact on cardiolipin levels during logarithmic growth

  • ΔclsABC triple mutants: Required to substantially diminish cardiolipin content across all growth phases

In S. flexneri, which has a similar cls system, deletion of clsA resulted in complete loss of detectable cardiolipin during exponential growth and a corresponding increase in phosphatidylglycerol levels . Similar patterns are expected in S. typhimurium based on the conservation of these enzymes across related Gram-negative bacteria.

What are the recommended methods for generating recombinant S. typhimurium cardiolipin synthase for in vitro studies?

For recombinant expression of S. typhimurium cardiolipin synthase, researchers should consider the following methodological approach:

  • Gene cloning: Amplify the cls gene of interest (clsA, clsB, or clsC) with appropriate restriction sites for insertion into expression vectors

  • Expression system selection: E. coli BL21(DE3) is commonly used for recombinant membrane protein expression

  • Vector optimization: Use vectors with inducible promoters (like pET system) and affinity tags (His6) for purification

  • Expression conditions: Optimize induction conditions (IPTG concentration, temperature, duration) for membrane protein expression

  • Membrane protein isolation: Use detergent-based extraction methods specifically designed for membrane proteins

  • Activity verification: Assess enzyme activity through phospholipid synthesis assays

When establishing expression systems, it's critical to verify that the recombinant enzyme maintains catalytic activity, as membrane proteins often require specific lipid environments to function properly. Complementation experiments in cls deletion strains can validate functionality of the recombinant enzyme .

How can researchers accurately measure cardiolipin levels in S. typhimurium experimental models?

Accurate quantification of cardiolipin in S. typhimurium requires specific lipid extraction and analytical techniques:

  • Lipid extraction: The Bligh-Dyer method is commonly employed for phospholipid isolation from bacterial cells

  • Separation techniques:

    • Thin-layer chromatography (TLC) provides visual comparison of phospholipid composition

    • High-performance liquid chromatography (HPLC) offers more precise quantification

    • Mass spectrometry provides detailed structural analysis of cardiolipin species

  • Quantification:

    • Phospholipids can be visualized with specific stains (e.g., molybdenum blue)

    • Densitometry analysis of TLC plates enables relative quantification

    • Internal standards allow for absolute quantification in mass spectrometry

As demonstrated in studies with S. flexneri, wild-type strains typically contain approximately 7% cardiolipin in exponential phase, while deletion of clsA can reduce this to undetectable levels with a concurrent increase in phosphatidylglycerol levels . Growth phase significantly affects cardiolipin levels, with higher proportions typically observed in stationary phase, requiring researchers to carefully control and document growth conditions in experimental protocols.

What strategies are effective for creating cls gene knockouts in S. typhimurium?

Creating precise cls gene knockouts in S. typhimurium requires careful consideration of the following strategies:

  • Lambda Red recombination system:

    • Most efficient method for generating targeted deletions

    • Requires PCR amplification of antibiotic resistance cassettes with flanking homology regions

    • Enables precise deletion without disrupting adjacent genes

  • Verification methods:

    • PCR confirmation of gene deletion

    • Sequencing to verify precise deletion boundaries

    • Phospholipid profile analysis to confirm functional consequences

  • Construction of multiple deletions:

    • Sequential deletion strategy using different antibiotic markers

    • FLP recombinase-mediated removal of resistance cassettes between deletions

    • Verification of each deletion step before proceeding

When creating cls deletion mutants, it's critical to confirm that the deletion has not affected expression of adjacent genes through polar effects. Complete characterization should include growth rate assessment, phospholipid analysis, and complementation studies to verify that phenotypes are specifically due to cls gene deletion .

How does the deletion of cls genes affect virulence and host interaction in S. typhimurium infection models?

Despite the regulation of cardiolipin levels during infection, studies have revealed unexpected findings regarding cls genes' contribution to virulence:

  • Virulence in mouse models:

    • The ΔclsABC triple mutant (devoid of cardiolipin) remains highly virulent during both oral and systemic infection in C57BL/6J mice

    • No significant attenuation was observed, contrary to initial hypotheses based on membrane composition changes

  • Intracellular survival:

    • Deletion mutants (ΔclsA, ΔclsB, ΔclsC, and combinations) show normal survival within macrophages

    • This suggests compensatory mechanisms maintain membrane function despite alterations in phospholipid composition

  • Inflammasome activation:

    • Cardiolipin deficiency does not significantly alter inflammasome activation during infection

    • This contrasts with studies showing that purified mitochondrial cardiolipin can activate inflammasomes

These findings indicate that while S. typhimurium regulates cardiolipin content during infection, cardiolipin synthesis genes are not essential for the bacterium's ability to survive within macrophages or cause disease in mouse models . This contradicts earlier hypotheses about the importance of bacterial cardiolipin in host-pathogen interactions and suggests the need for further investigation into the specific roles of these phospholipids during infection.

What is the relationship between cardiolipin synthesis and antibiotic resistance in S. typhimurium?

The relationship between cardiolipin synthesis and antibiotic resistance in S. typhimurium involves several complex mechanisms:

Studies with S. typhimurium L-forms demonstrated that while inhibition zones were smaller than in parent bacteria, the L-forms remained sensitive to third-generation cephalosporins (cefotaxime, ceftriaxone, cefoperazone, ceftazidime) and fourth-generation cephalosporin (cefepime) . The relationship between cardiolipin synthesis and these resistance patterns warrants further investigation, particularly as it relates to persistent infections.

How do growth conditions affect the relative contributions of different cls genes to cardiolipin synthesis?

Growth conditions significantly influence the relative contributions of different cardiolipin synthase enzymes in S. typhimurium:

  • Growth phase effects:

    • ClsA is the primary synthase during logarithmic growth phase

    • ClsB and ClsC make greater contributions during stationary phase

    • All three enzymes may be necessary for full cardiolipin synthesis throughout the bacterial life cycle

  • Environmental stress responses:

    • Acidic pH, osmotic stress, and nutrient limitation can alter cls gene expression

    • These conditions are often encountered during infection and may trigger shifts in cls gene utilization

  • Temperature variations:

    • Temperature shifts can change membrane phospholipid composition

    • Different cls enzymes may be differentially regulated at host body temperature versus environmental temperatures

Research in related species (S. flexneri) has shown that ClsC makes a more substantial contribution to cardiolipin synthesis during stationary phase than during exponential growth . This growth phase-dependent regulation suggests specialized roles for different cardiolipin synthases under different physiological conditions, which should be considered when designing experiments to study these enzymes.

What are the key considerations when analyzing the function of recombinant cardiolipin synthase in heterologous expression systems?

When analyzing recombinant cardiolipin synthase function in heterologous systems, researchers should address these critical considerations:

  • Membrane integration challenges:

    • Cardiolipin synthases are membrane proteins that require proper folding and insertion

    • Expression conditions should be optimized for membrane protein production (lower temperature, mild induction)

    • Detergent selection for solubilization is critical for maintaining enzyme structure and function

  • Substrate availability:

    • Ensure adequate phospholipid substrate availability in the expression host

    • Consider supplementing with phosphatidylglycerol if using non-bacterial expression systems

  • Activity assessment:

    • In vitro activity assays should mimic the native membrane environment

    • Reconstitution in liposomes may provide a more native-like environment than detergent solubilization

    • Complementation of cls deletion mutants provides functional validation

  • Protein purification challenges:

    ChallengeRecommended Solution
    Detergent selectionScreen multiple detergents (DDM, LDAO, FC-12) for optimal solubilization
    Protein aggregationInclude stabilizing agents (glycerol, specific lipids) in purification buffers
    Activity loss during purificationMinimize time between extraction and activity assays
    Yield optimizationConsider fusion partners (MBP, SUMO) to enhance solubility

Successful heterologous expression may require careful optimization of these parameters to ensure that the recombinant enzyme properly represents the native enzyme's function .

How can researchers effectively study the interaction between cardiolipin and the host immune system in S. typhimurium infections?

Studying cardiolipin-host immune interactions in S. typhimurium infections requires specialized approaches:

  • Purification of bacterial cardiolipin:

    • Extract cardiolipin from wild-type and mutant S. typhimurium strains

    • Purify using chromatographic methods to eliminate contaminating LPS

    • Verify purity using mass spectrometry analysis

  • Inflammasome activation assays:

    • Measure caspase-1 activation in macrophages exposed to purified cardiolipin

    • Compare responses to bacterial versus mitochondrial cardiolipin

    • Use specific inflammasome component knockouts (NLRP3, NLRC4) to distinguish activation pathways

  • In vivo infection models:

    • Compare inflammatory responses to wild-type and ΔclsABC mutants

    • Analyze cytokine profiles in infected tissues

    • Examine immune cell recruitment and activation

Research findings indicate a complex relationship between bacterial cardiolipin and immune activation. While mitochondrial cardiolipin molecules can activate inflammasomes, the contribution of S. typhimurium cardiolipin to inflammasome activation during infection appears minimal, as cls-deficient mutants still effectively activate inflammasomes . This suggests that other bacterial components (e.g., flagellin, LPS, PrgJ) may play more dominant roles in immune detection during infection.

What approaches can resolve conflicting research findings regarding the importance of cardiolipin in S. typhimurium virulence?

To address conflicting findings about cardiolipin's role in S. typhimurium virulence, consider these methodological approaches:

  • Strain-specific differences:

    • Compare multiple S. typhimurium strains and isolates

    • Sequence cls genes to identify potential polymorphisms

    • Standardize genetic backgrounds for comparative studies

  • Infection model variations:

    • Employ different mouse strains (BALB/c, C57BL/6) to assess host-specific effects

    • Compare results from different infection routes (oral vs. intraperitoneal)

    • Consider alternative infection models (e.g., gallbladder infection models)

  • Compensatory mechanisms investigation:

    • Perform comprehensive lipidomic analysis to identify membrane composition changes in cls mutants

    • Conduct RNA-seq to identify upregulated genes that may compensate for cardiolipin deficiency

    • Create combinatorial mutants affecting multiple phospholipid pathways

  • More sensitive virulence assays:

    • Competitive infection assays between wild-type and mutant strains

    • Long-term persistence models to detect subtle fitness defects

    • Stress-enhanced infection models that may reveal conditional phenotypes

Despite evidence that S. typhimurium regulates cardiolipin levels during infection, the ΔclsABC mutant remains highly virulent during infection in mouse models . This apparent contradiction suggests cardiolipin may play subtle roles in specific infection contexts or may have redundant functions in membrane homeostasis that are compensated by other phospholipids.

What new technologies might advance our understanding of cardiolipin synthase functions in S. typhimurium?

Emerging technologies offer promising approaches to further elucidate cardiolipin synthase functions:

  • CRISPR interference (CRISPRi) for temporal control:

    • Allows tunable and reversible repression of cls genes

    • Enables study of acute cardiolipin depletion effects

    • Can reveal phenotypes masked by compensatory mechanisms in knockout studies

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize cardiolipin distribution in bacterial membranes

    • Correlative light and electron microscopy to link cardiolipin localization with ultrastructural features

    • Lipid-specific probes for live-cell tracking of cardiolipin dynamics

  • Single-cell analysis methods:

    • Microfluidic techniques to study cardiolipin's role in bacterial heterogeneity

    • Single-cell RNA-seq to identify transcriptional responses to cardiolipin deficiency

    • Time-lapse microscopy to track membrane changes during infection process

  • Structural biology approaches:

    • Cryo-EM structures of cardiolipin synthases to understand catalytic mechanisms

    • Molecular dynamics simulations to predict how mutations affect enzyme function

    • Protein-lipid interaction studies to identify cardiolipin-binding proteins

These technologies could help resolve the apparent contradictions in current research findings and elucidate the specific contexts in which cardiolipin synthesis becomes critical for bacterial survival and virulence .

How might a better understanding of cardiolipin synthesis in S. typhimurium contribute to new antimicrobial strategies?

Understanding cardiolipin synthesis in S. typhimurium could inform novel antimicrobial strategies through several potential approaches:

  • Combination therapy opportunities:

    • Cls inhibitors could potentially sensitize bacteria to existing antibiotics

    • L-form induction combined with cell wall-independent killing mechanisms

    • Targeting cardiolipin-dependent processes during specific infection stages

  • Membrane-targeting compounds:

    • Design antimicrobials that exploit altered membrane properties in specific environments

    • Develop compounds that disrupt cardiolipin-rich membrane domains

    • Target enzymes involved in phospholipid homeostasis

  • Host-directed therapies:

    • Modulate host responses to bacterial cardiolipin

    • Target host factors that interact with bacterial membrane components

    • Develop immunomodulatory approaches based on cardiolipin-host interactions

Research on S. typhimurium L-forms suggests that complete pathogen removal may require combination approaches targeting both cell wall synthesis and membrane functions . While cls genes aren't essential for virulence, understanding their regulatory networks may reveal conditional vulnerabilities that could be exploited therapeutically in specific infection contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.