Recombinant Salmonella typhimurium Cell invasion protein sipB (sipB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
sipB; sspB; STM2885; Cell invasion protein SipB; Effector protein SipB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
sipB
Target Protein Sequence
MVNDASSISRSGYTQNPRLAEAAFEGVRKNTDFLKAADKAFKDVVATKAGDLKAGTKSGE SAINTVGLKPPTDAAREKLSSEGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKE MGIQVSKEFQTALGEAQEATDLYEASIKKTDTAKSVYDAATKKLTQAQNKLQSLDPADPG YAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNILTKFQGTANAASQN QVSQGEQDNLSNVARLTMLMAMFIEIVGKNTEESLQNDLALFNALQEGRQAEMEKKSAEF QEETRKAEETNRIMGCIGKVLGALLTIVSVVAAVFTGGASLALAAVGLAVMVADEIVKAA TGVSFIQQALNPIMEHVLKPLMELIGKAITKALEGLGVDKKTAEMAGSIVGAIVAAIAMV AVIVVVAVVGKGAAAKLGNALSKMMGETIKKLVPNVLKQLAQNGSKLFTQGMQRITSGLG NVGSKMGLQTNALSKELVGNTLNKVALGMEVTNTAAQSAGGVAEGVFIKNASEALADFML ARFAMDQIQQWLKQSVEIFGENQKVTAELQKAMSSAVQQNADASRFILRQSRA
Uniprot No.

Target Background

Function
SipB is crucial for host cell entry via SipC presentation or delivery at the plasma membrane. It facilitates the transfer of other effector proteins into the host cell, along with SipC. SipB induces macrophage apoptosis through two mechanisms: caspase-1-dependent apoptosis (activating caspase-1, leading to interleukin-1 beta release), and caspase-1-independent apoptosis (disrupting mitochondria and inducing autophagy). The caspase-1-dependent pathway relies on its membrane-fusion activity. The SipBC complex, with its chaperone SicA, is regulated by InvE binding.
Gene References Into Functions
  1. Studies demonstrate that while SipB does not affect Salmonella growth, it significantly reduces adherence, invasion, and virulence in a Salmonella Typhimurium SL1344 mutant compared to the wild type. PMID: 26341924
  2. Research indicates that the Salmonella virulence translocon SipB impacts membrane fluidity and alters bacterial osmotolerance. PMID: 22975346
  3. Newly identified domains within IpaB and SipB consist of extended coiled-coil motifs (114 Å in IpaB and 71 Å in SipB), exhibiting significant structural homology despite only 21% sequence identity. PMID: 22321794
  4. SipB, a translocon component, exhibits high-affinity cholesterol binding. Cholesterol-dependent association of the translocon with the target cell plasma membrane is critical for translocon activation and effector delivery into mammalian cells. PMID: 15819617
  5. Amino acids 3-8 of SipB are essential for its bacterial secretion, and the SicA chaperone binds to SipB between amino acids 80 and 100 in the N-terminal region. PMID: 17768243
Database Links

KEGG: stm:STM2885

STRING: 99287.STM2885

Protein Families
Invasin protein B family
Subcellular Location
Secreted. Host cell membrane; Multi-pass membrane protein. Note=Secreted via the type III secretion system 1 (SPI-1 TTSS), inserted into the phagosomal membrane and subsequently released into the host cell cytoplasm.

Q&A

What is SipB protein and what is its function in Salmonella pathogenesis?

SipB (also known as sspB) is a cell invasion protein that serves as a pathogenicity island 1 effector protein in Salmonella typhimurium . It functions as a critical component of the SPI-1 type III secretion system (T3SS), specifically as part of the needle tip complex that forms a translocon in the host cell membrane . This protein plays a dual role in Salmonella pathogenesis:

  • It facilitates bacterial invasion by forming pores in host cell membranes

  • It induces macrophage cell death through interaction with caspase-1

The protein is encoded by the sipB gene, which has been detected in 99.02% of Salmonella serovars according to recent PCR analyses . As part of the invasion process, SipB works in conjunction with other Salmonella invasion proteins to deliver bacterial effectors into host cells, triggering cytoskeletal rearrangements that enable bacterial internalization.

How does SipB contribute to Salmonella-induced cell death mechanisms?

SipB contributes to Salmonella-induced cell death through multiple mechanisms, primarily through what researchers have characterized as SipB-dependent cell death. Experimental evidence shows that SipB-dependent cell death occurs rapidly (within 2 hours of infection) and relies on the interaction between SipB and caspase-1 .

When macrophages are infected with Salmonella, SipB binds directly to caspase-1, leading to its activation. This activation triggers:

  • Proteolytic processing of pro-inflammatory cytokines (particularly IL-1β)

  • Rapid inflammatory cell death (pyroptosis)

Research using caspase-1 inhibitors such as Ac-YVAD-cmk has demonstrated that macrophages can be protected against early SipB-dependent cell death, with inhibitor-treated cells showing 75-85% survival compared to untreated controls . This protection is MOI-dependent (multiplicity of infection), suggesting a dose-response relationship between bacterial load and cell death induction.

Importantly, IL-1β production in response to Salmonella infection has been shown to be largely caspase-1 dependent regardless of SipB presence, indicating complex regulatory mechanisms beyond direct SipB-caspase-1 interactions .

What experimental approaches are recommended for studying SipB functions?

To effectively study SipB functions, researchers should employ multiple complementary approaches:

Genetic Manipulation:

  • Generation of sipB mutant strains via targeted gene deletion

  • Complementation studies using recombinant SipB expression

  • Site-directed mutagenesis to identify functional domains

Protein Expression and Purification:

  • Recombinant protein expression using E. coli, yeast, baculovirus, or mammalian cell systems

  • Affinity chromatography purification to achieve ≥85% purity as determined by SDS-PAGE

  • Verification of protein identity via Western blotting using anti-SipB antibodies

Cellular Assays:

  • Bone marrow-derived macrophage (BMDM) infection models

  • Gentamicin protection assays to quantify intracellular bacterial loads

  • Cell death assessment using LDH release or other cytotoxicity measurements

For optimal results in macrophage infection models, bone marrow-derived macrophages should be used within 14 days after isolation, as extended culture beyond this period has been shown to result in reduced bacterial uptake and consequently fewer bacteria per macrophage .

How do SipB-dependent and SipB-independent cell death pathways differ mechanistically?

The mechanistic differences between SipB-dependent and SipB-independent cell death pathways represent a critical area of investigation. Based on experimental evidence:

SipB-dependent pathway:

  • Occurs rapidly (2 hours post-infection)

  • Requires direct interaction between SipB and caspase-1

  • Results in 75-85% cell death in an MOI-dependent manner

  • Is effectively inhibited by caspase-1 inhibitors like Ac-YVAD-cmk

  • Functions independently of TLR4 signaling

SipB-independent pathway:

  • Occurs later (24 hours post-infection)

  • Requires TLR4 signaling through the Tram/Trif adapter proteins

  • Results in 40-50% cell death in wild-type macrophages

  • Is not inhibited by caspase-1 inhibitors

  • Is completely absent in TLR4-deficient macrophages

Research using knockout models has demonstrated that while wild-type S. typhimurium kills >95% of both TLR4+/+ and TLR4-/- macrophages at 24 hours, sipB mutant strains kill 50-70% of TLR4+/+ BMDMs but cause little to no cell death in TLR4-/- BMDMs . This striking difference is not attributable to differences in bacterial uptake, as gentamicin protection assays show similar numbers of intracellular Salmonella in both cell types at 2 hours post-infection .

Further mechanistic studies have revealed that the SipB-independent pathway specifically requires the Tram/Trif signaling branch downstream of TLR4, as both Tram-/- and Trif-/- BMDMs are resistant to SipB-independent cell death .

What experimental controls should be included when analyzing SipB-mediated cellular responses?

When analyzing SipB-mediated cellular responses, the following experimental controls should be included to ensure valid and reliable results:

Genetic Controls:

  • Wild-type Salmonella typhimurium (positive control)

  • sipB mutant Salmonella (to distinguish SipB-dependent effects)

  • Complemented sipB mutant (to confirm phenotype restoration)

Host Cell Controls:

  • Wild-type macrophages (typically bone marrow-derived)

  • TLR4-/- macrophages (to assess TLR4 dependence)

  • Tram-/- and Trif-/- macrophages (to evaluate adaptor protein roles)

  • MyD88-/- and Mal-/- macrophages (as pathway-specific controls)

Treatment Controls:

  • Caspase-1 inhibitor (e.g., Ac-YVAD-cmk)

  • Various MOI conditions (typically 10 and 30)

  • Time point series (2h and 24h at minimum)

  • Gentamicin protection assays (to normalize for bacterial uptake)

Readout Controls:

  • Cell death assessment using multiple methods (e.g., LDH release, PI staining)

  • Cytokine measurements (particularly IL-1β)

  • Protein expression verification via Western blot

  • Bacterial burden quantification

A typical experimental matrix should include combinations of these variables to disentangle the complex interactions between SipB-dependent and independent pathways. When reporting results, researchers should present data in standardized table formats that clearly indicate both independent variables (genetic background, treatments) and dependent variables (cell death percentages, cytokine levels) with appropriate statistical analyses.

How do bacterial growth conditions affect SipB expression and function?

Bacterial growth conditions significantly impact SipB expression and function, representing a critical variable that researchers must standardize and report. The stage of bacterial growth has been demonstrated to influence the expression of SipB and other type III secretion system components, directly affecting the results of in vitro studies on S. typhimurium-induced cell death .

Key parameters that affect SipB expression include:

Growth Phase:

  • Log phase bacteria typically express higher levels of SipB

  • Stationary phase bacteria may downregulate T3SS components

  • Growth phase should be standardized and reported in all experimental protocols

Media Composition:

  • LPS production levels vary with media composition

  • Minimal vs. rich media affect virulence gene expression

  • pH and oxygen tension impact SPI-1 gene regulation

Bacterial Strain Variations:

  • Different Salmonella strains may produce varying levels of LPS

  • Laboratory-adapted strains may have altered virulence gene expression

  • Clinical isolates may exhibit different SipB expression patterns

To account for these variables, researchers should implement the following methodological approaches:

  • Standardize bacterial growth protocols, including media composition, temperature, and aeration

  • Harvest bacteria at consistent optical density values

  • Verify SipB expression levels via Western blot before infection experiments

  • Report detailed bacterial growth conditions in all publications

  • Consider including strain verification via PCR detection of virulence genes

Recent PCR-based studies have shown that the sipB gene can be detected in 99.02% of Salmonella serovars, making it a highly conserved virulence factor across different strains .

What are the optimal conditions for expressing and purifying recombinant SipB protein?

The optimal conditions for expressing and purifying recombinant SipB protein depend on the experimental requirements and downstream applications. Based on current methodologies:

Expression Systems:
Several expression systems have been successfully used for SipB production:

  • E. coli-based expression (most common for structural studies)

  • Yeast expression systems (for post-translational modifications)

  • Baculovirus-infected insect cells (for complex proteins)

  • Mammalian cell expression (for functional studies)

  • Cell-free expression systems (for rapid production)

Purification Strategy:

  • Express with appropriate affinity tag (His6, GST, or MBP)

  • Perform initial capture via affinity chromatography

  • Implement secondary purification via ion exchange or size exclusion

  • Verify purity via SDS-PAGE (target ≥85% purity)

  • Confirm identity via Western blot and/or mass spectrometry

Buffer Optimization:
SipB is a membrane-interacting protein, so buffer conditions are critical:

  • Consider including mild detergents (0.05-0.1% DDM or LDAO)

  • Test protein stability in various pH conditions (typically pH 7.0-8.0)

  • Include glycerol (5-10%) to improve stability

  • Add reducing agents to prevent oxidation of cysteine residues

Quality Control:

  • Assess purity via SDS-PAGE (target ≥85-95% purity)

  • Verify proper folding via circular dichroism

  • Test functionality via liposome binding assays

  • Perform batch consistency testing for reproducibility

Expression SystemYield (mg/L)Purity (%)AdvantagesLimitations
E. coli5-15≥85High yield, low costLimited PTMs
Yeast2-8≥85Some PTMsModerate yield
Baculovirus1-5≥85Complex PTMsHigher cost
Mammalian0.5-2≥85Native PTMsLowest yield, highest cost
Cell-free0.5-3≥85Rapid productionLimited scalability

Note: Data compiled from product specifications and literature. PTMs = Post-translational modifications

How can researchers effectively design experiments to distinguish between SipB-dependent and SipB-independent cell death pathways?

To effectively distinguish between SipB-dependent and SipB-independent cell death pathways, researchers should implement a comprehensive experimental design that incorporates genetic, pharmacological, and temporal approaches:

Genetic Approach:

  • Use wild-type S. typhimurium and isogenic sipB mutant strains

  • Include host cells with various genetic backgrounds:

    • Wild-type macrophages

    • TLR4-/- macrophages

    • Tram-/- and Trif-/- macrophages

    • Caspase-1-/- macrophages

Temporal Analysis:

  • Measure cell death at multiple time points:

    • Early time points (2 hours) to capture SipB-dependent mechanisms

    • Late time points (24 hours) to assess SipB-independent effects

  • Include intermediate time points to track the transition between pathways

Pharmacological Interventions:

  • Use caspase-1 inhibitors (e.g., Ac-YVAD-cmk) to block SipB-dependent pathways

  • Apply TLR4 signaling inhibitors to disrupt SipB-independent mechanisms

  • Test PKR inhibitors to evaluate downstream effects in the Tram/Trif pathway

Multiplicity of Infection (MOI) Titration:
Use multiple MOI values (typically 10 and 30) to assess dose-dependent effects .

Recommended Experimental Matrix:

Cell TypeBacteriaInhibitorMOITime Points (hours)Readouts
WT BMDMWT S. typhimuriumNone10, 302, 8, 24Cell death, IL-1β, bacterial burden
WT BMDMsipB mutantNone10, 302, 8, 24Cell death, IL-1β, bacterial burden
WT BMDMWT S. typhimuriumCaspase-1 inhibitor10, 302, 8, 24Cell death, IL-1β, bacterial burden
WT BMDMsipB mutantCaspase-1 inhibitor10, 302, 8, 24Cell death, IL-1β, bacterial burden
TLR4-/- BMDMWT S. typhimuriumNone10, 302, 8, 24Cell death, IL-1β, bacterial burden
TLR4-/- BMDMsipB mutantNone10, 302, 8, 24Cell death, IL-1β, bacterial burden
Tram-/- BMDMWT S. typhimuriumNone10, 302, 8, 24Cell death, IL-1β, bacterial burden
Tram-/- BMDMsipB mutantNone10, 302, 8, 24Cell death, IL-1β, bacterial burden

Key findings from such experimental designs have revealed that:

  • Early (2h) SipB-dependent cell death is not affected in TLR4-/- macrophages

  • Late (24h) sipB mutant-induced cell death is completely abolished in TLR4-/- macrophages

  • Both Tram-/- and Trif-/- macrophages are resistant to SipB-independent cell death and may actually proliferate during infection

What are the contradictory findings in the literature regarding SipB function and how can researchers address these discrepancies?

The literature contains several notable contradictions regarding SipB function that researchers should be aware of when designing experiments:

Contradiction 1: Role of TLR4 in SipB-independent cell death

  • Hsu et al. demonstrated reduced SipB-independent cell death in C3H/HeJ mice (TLR4-deficient) compared to C3H/HeN (wild-type TLR4)

  • In contrast, Weiss et al. detected neither delayed Salmonella-induced cell death at 24h nor differences in macrophage survival between TLR4+/+ and TLR4-/- BMDMs

Potential factors explaining this discrepancy:

  • Different Salmonella strains used across studies

  • Variations in bacterial growth protocols affecting LPS levels

  • Different bacterial growth phases altering protein expression profiles

  • Methodological differences in cell death assessment

Contradiction 2: Mechanism of SipB-independent cell death

  • Some studies suggest PKR (protein kinase) dependency downstream of TLR4/Tram/Trif

  • Other research emphasizes alternative pathways or additional factors

Contradiction 3: SipB prevalence across Salmonella serovars

  • While recent PCR studies show sipB gene detection in 99.02% of Salmonella serovars , functional expression levels may vary significantly

To address these discrepancies, researchers should consider the following methodological approaches:

  • Standardize experimental protocols:

    • Use consistent bacterial growth conditions

    • Standardize macrophage preparation methods

    • Apply multiple cell death assessment techniques

  • Perform direct comparative studies:

    • Test multiple Salmonella strains side-by-side

    • Include both C3H/HeJ and TLR4 knockout models

    • Directly compare results using identical methodologies

  • Implement comprehensive controls:

    • Include proper genetic controls (wild-type, mutant, complemented strains)

    • Use pharmacological inhibitors alongside genetic approaches

    • Verify key findings with multiple technical and biological replicates

  • Measure bacterial parameters:

    • Quantify LPS levels in different bacterial preparations

    • Assess SipB expression levels via Western blot

    • Monitor bacterial growth stage carefully

  • Data reporting recommendations:

    • Clearly document all experimental conditions

    • Present complete datasets including negative results

    • Provide detailed methodological descriptions

By addressing these contradictions through rigorous experimental design and transparent reporting, researchers can help resolve existing discrepancies and advance our understanding of SipB function in Salmonella pathogenesis.

How can recombinant SipB be utilized in vaccine development and immunological studies?

Recombinant SipB protein offers significant potential for vaccine development and immunological studies due to its conserved nature across Salmonella serovars (detected in 99.02% of strains) and its critical role in pathogenesis:

Vaccine Development Applications:

  • Subunit vaccine component:

    • Purified recombinant SipB (≥85% purity) can be formulated with appropriate adjuvants

    • Key epitopes can be identified and incorporated into peptide vaccines

    • Expression in various systems allows for different post-translational modifications

  • Attenuated vaccine strain design:

    • SipB mutants with reduced cytotoxicity but maintained immunogenicity

    • Engineered strains expressing modified SipB with enhanced immunostimulatory properties

    • Balanced attenuation to maintain protective immunity while reducing pathogenicity

  • Adjuvant development:

    • SipB's interaction with innate immune receptors could be harnessed for adjuvant design

    • Specific domains may be utilized to enhance immune responses to co-delivered antigens

Immunological Research Applications:

  • T-cell response studies:

    • Mapping SipB-specific T-cell epitopes

    • Characterizing memory T-cell responses to SipB

    • Exploring cross-reactivity with other bacterial antigens

  • Innate immunity investigations:

    • Using recombinant SipB to study TLR4-mediated signaling pathways

    • Examining the interplay between SipB and inflammasome activation

    • Investigating the role of SipB in modulating macrophage functions

  • Methodological considerations:

    • Ensure endotoxin removal during protein purification

    • Verify protein conformation and stability

    • Include appropriate controls for immunogenicity studies

Research Protocol Recommendation:
For immunological studies, researchers should consider the following experimental approach:

  • Express SipB in an appropriate system (E. coli for structural studies, mammalian cells for functional studies)

  • Purify to ≥85% purity using affinity chromatography followed by secondary purification

  • Verify endotoxin levels (<0.1 EU/μg protein)

  • Characterize protein structure and stability

  • Design immunization protocols with appropriate controls

  • Assess both humoral and cellular immune responses

  • Challenge with virulent Salmonella to evaluate protection

What are the methodological challenges in studying SipB interactions with host cellular components?

Studying SipB interactions with host cellular components presents several methodological challenges that researchers must address:

Challenge 1: Protein Expression and Purification

  • SipB is a large (62 kDa) protein with hydrophobic domains

  • It may require detergents for solubilization

  • Native conformation is critical for functional studies

Solution approaches:

  • Test multiple expression systems (E. coli, yeast, baculovirus, mammalian cells)

  • Optimize buffer conditions with various detergents

  • Consider expressing functional domains separately

  • Use protein quality assessments beyond SDS-PAGE (e.g., circular dichroism, dynamic light scattering)

Challenge 2: Studying Membrane Interactions

  • SipB forms pores in host membranes

  • Interactions are transient and may depend on other bacterial factors

  • Artificial membrane systems may not fully recapitulate native environments

Solution approaches:

  • Implement liposome binding and permeabilization assays

  • Use atomic force microscopy to visualize membrane interactions

  • Develop cell-based assays with fluorescent markers for pore formation

  • Apply super-resolution microscopy techniques

Challenge 3: Tracking Intracellular Dynamics

  • SipB's interactions with caspase-1 occur in complex cellular environments

  • Distinguishing direct from indirect effects is challenging

  • Temporal dynamics are critical but difficult to capture

Solution approaches:

  • Use fluorescently tagged SipB variants (verify functionality)

  • Implement live-cell imaging with appropriate markers

  • Apply proximity ligation assays for protein-protein interactions

  • Develop inducible expression systems for temporal control

Challenge 4: Distinguishing Pathway-Specific Effects

  • SipB contributes to multiple cellular outcomes

  • Separating caspase-1-dependent from TLR4-dependent effects is complex

  • Host genetic background influences outcomes

Solution approaches:

  • Use systematic genetic approaches (knockout cells, CRISPR screens)

  • Implement phosphoproteomic analyses to map signaling networks

  • Apply pharmacological inhibitors with appropriate controls

  • Design factorial experiments to detect interaction effects

A comprehensive approach to studying SipB-host interactions should incorporate multiple complementary techniques and careful controls to address these challenges. Researchers should consider collaboration across disciplines (structural biology, cell biology, immunology) to fully characterize these complex interactions.

How does SipB function compare across different Salmonella serovars and what are the implications for research methodology?

SipB function exhibits both conservation and variation across different Salmonella serovars, which has important implications for research methodology:

Conservation Across Serovars:

  • PCR detection shows sipB present in 99.02% of Salmonella serovars tested

  • High conservation suggests evolutionary importance

  • Core functional domains likely preserved across strains

Variation Aspects:

  • Expression levels may differ between serovars

  • Regulatory mechanisms controlling SipB expression can vary

  • Interaction with host factors may show host-specificity

  • Functional importance may vary in different infection models

Methodological Implications:

  • Strain Selection Considerations:

    • Studies should clearly identify the specific Salmonella serovar used

    • Comparative analyses across multiple serovars provide broader relevance

    • Host-adapted serovars may yield different results than generalist strains

  • Experimental Design Recommendations:

    • Include multiple representative serovars when possible

    • Test recombinant SipB from different serovars when studying function

    • Consider host specificity when selecting infection models

  • Variability Assessment:

    • Quantify SipB expression levels across serovars

    • Perform functional comparisons using standardized assays

    • Identify strain-specific differences in host response

  • Cross-Serovar Analysis Approach:

Analysis TypeMethodologyExpected OutcomeResearch Value
Sequence analysisComparative genomicsIdentification of conserved/variable regionsTarget selection for broadly effective interventions
Expression profilingqRT-PCR, Western blotQuantitative differences in expression levelsUnderstanding regulatory mechanisms
Functional assaysCell death assays, invasion assaysStrain-specific functional differencesCorrelation between sequence and function
Host responseCytokine profiling, transcriptomicsDifferential host responsesHost-pathogen interaction insights
  • Research Applications:

    • Vaccine development should target conserved SipB epitopes

    • Diagnostic tools can exploit serovar-specific variations

    • Therapeutic approaches should consider conservation patterns

    • Basic research should acknowledge serovar limitations

  • Technical Considerations:

    • PCR detection should use primers targeting conserved regions

    • Antibodies may have variable cross-reactivity between serovars

    • Expression systems should be optimized for each serovar studied

By systematically accounting for these cross-serovar considerations, researchers can develop more robust and broadly applicable findings regarding SipB function and its role in Salmonella pathogenesis.

What are the key methodological recommendations for researchers working with recombinant SipB protein?

Based on current research and experimental findings, researchers working with recombinant SipB protein should consider the following key methodological recommendations:

  • Expression System Selection:

    • Choose expression systems based on experimental goals:

      • E. coli or cell-free systems for structural studies

      • Mammalian cells for functional analyses

      • Ensure ≥85% purity via appropriate purification methods

  • Experimental Design Principles:

    • Include both early (2h) and late (24h) time points to distinguish pathway effects

    • Use multiple MOI values (10 and 30 recommended) to assess dose-dependent responses

    • Incorporate appropriate genetic controls (wild-type, sipB mutant, complemented strains)

    • Account for bacterial growth conditions as they significantly impact results

  • Pathway Delineation Approach:

    • Use TLR4-/-, Tram-/-, and Trif-/- macrophages to dissect signaling mechanisms

    • Implement caspase-1 inhibitors (e.g., Ac-YVAD-cmk) to block SipB-dependent pathways

    • Measure both cell death and cytokine production (particularly IL-1β)

    • Verify bacterial uptake via gentamicin protection assays to normalize results

  • Contradictory Findings Resolution:

    • Standardize bacterial growth protocols across studies

    • Directly compare C3H/HeJ mice with TLR4 knockout models

    • Report detailed methodologies to enable reproduction

    • Address strain differences through comparative analyses

  • Data Presentation Standards:

    • Present data in standardized tables with clearly labeled variables

    • Include all necessary experimental conditions

    • Report both positive and negative results

    • Provide statistical analyses with appropriate tests

These methodological recommendations aim to enhance experimental rigor, reproducibility, and cross-study comparisons in SipB research, ultimately advancing our understanding of Salmonella pathogenesis mechanisms.

What future research directions should be prioritized to advance our understanding of SipB function?

To advance our understanding of SipB function in Salmonella pathogenesis, the following future research directions should be prioritized:

  • Structural and Functional Domain Mapping:

    • Determine high-resolution crystal or cryo-EM structures of SipB

    • Map functional domains through systematic mutagenesis

    • Characterize membrane insertion mechanisms at molecular level

    • Identify critical residues for caspase-1 interaction

  • Cross-Talk Between Pathways:

    • Investigate the interplay between SipB-dependent and SipB-independent pathways

    • Characterize the temporal transition between different cell death mechanisms

    • Identify additional host factors involved in SipB-mediated responses

    • Examine how SipB interfaces with other Salmonella effectors

  • Host-Specific Adaptations:

    • Compare SipB function across different host species

    • Identify host factors that determine susceptibility to SipB-mediated effects

    • Characterize variations in SipB function across Salmonella serovars

    • Investigate evolutionary adaptations in SipB structure and function

  • Translational Applications:

    • Develop SipB-based vaccine components

    • Design inhibitors targeting SipB-host interactions

    • Explore diagnostic applications based on SipB detection

    • Investigate SipB as a potential drug delivery platform

  • Advanced Methodological Approaches:

    • Implement systems biology approaches to map SipB-induced networks

    • Apply single-cell analyses to characterize heterogeneous responses

    • Develop organoid models to study SipB in complex tissue environments

    • Utilize advanced imaging techniques to visualize SipB dynamics in vivo

  • Contradictions Resolution:

    • Directly address discrepancies in TLR4 dependency reported by different groups

    • Standardize experimental protocols across research communities

    • Establish collaborative networks for multi-laboratory validation studies

    • Develop consensus guidelines for SipB research methodologies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.