Recombinant Salmonella typhimurium Cysteine/O-acetylserine efflux protein (eamB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella typhimurium Cysteine/O-acetylserine Efflux Protein (eamB)

The Recombinant Salmonella typhimurium Cysteine/O-acetylserine efflux protein, referred to as eamB, is a protein involved in the efflux of cysteine and O-acetylserine from the bacterial cell. This protein plays a crucial role in maintaining the intracellular balance of these amino acids, which are essential for various metabolic processes within the bacterium. The recombinant form of this protein is produced through genetic engineering techniques, allowing for its use in research and potential applications in biotechnology and medicine.

References

  1. ELISA Recombinant Salmonella typhimurium Cysteine-O-acetylserine efflux protein (eamB): Available from Colorectal Research, this product provides details on the recombinant protein's characteristics and storage conditions .

  2. General Information on Salmonella typhimurium: While not directly focused on eamB, general studies on Salmonella typhimurium can provide context on the bacterium's metabolic processes and the importance of efflux proteins .

  3. Recombinant Protein Production: Techniques for producing recombinant proteins in E. coli are well-established and can be applied to the production of eamB .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, centrifuge the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
eamB; STM2645; Cysteine/O-acetylserine efflux protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-195
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
eamB
Target Protein Sequence
MTPMLLSAFWTYTLITALTPGPNNILALSAATAHGFRQSIRVLAGMSLGFLVVMLLCAGI AFSLAVIDPAIIHLLSWVGAAYILWLAWKIATSPAADENARPKPVGFWVSFGLQFVNVKI ILYGITALSTFVLPQTQALNWVIGVSILLALIGTFGNVCWALAGHLFQRAFRHYGRQLNI ILALLLVYCAVRIFY
Uniprot No.

Target Background

Function
Exporter of O-acetylserine (OAS) and cysteine.
Database Links

KEGG: stm:STM2645

STRING: 99287.STM2645

Protein Families
Rht family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What experimental approaches are most effective for confirming eamB expression in recombinant systems?

Confirmation of eamB expression requires multiple complementary approaches. Western blot analysis using anti-His tag antibodies (if His-tagged constructs are used) provides basic confirmation. SDS-PAGE analysis followed by mass spectrometry can verify protein identity. Additionally, flow cytometry can be employed to assess protein expression levels in bacterial populations, similar to techniques used for OmpA detection in S. typhimurium . For quantitative assessment, ELISA-based methods may be developed using specific antibodies against eamB or epitope tags.

How can I assess the proper localization of recombinant eamB protein?

Membrane fractionation is the gold standard for confirming proper localization. This involves:

  • Differential centrifugation to separate cellular compartments

  • Extraction of membrane fractions using detergents

  • Analysis of fractions by western blotting

  • Confirmation with fluorescence microscopy using tagged eamB constructs

Techniques used for studying OmpA and OmpD localization in S. typhimurium can be adapted, as these have been well-established for transmembrane proteins .

What growth conditions optimize the expression of native eamB in S. typhimurium?

Optimizing growth conditions requires systematic testing of:

Growth ParameterRange to TestMonitoring Method
Temperature25°C - 42°CqRT-PCR for eamB expression
Media compositionVarying cysteine/sulfur sourcesProtein expression analysis
Growth phaseLog vs. stationaryWestern blot quantification
Oxygen levelsAerobic vs. microaerobicComparative proteomics
pH5.0 - 8.0Reporter gene assays

Similar approaches have been used for studying OmpA expression conditions in S. typhimurium, where protein expression varies with environmental conditions .

What methods can reliably measure the efflux activity of recombinant eamB?

To measure efflux activity, several complementary approaches can be implemented:

  • Radioactive substrate accumulation assays using labeled cysteine/O-acetylserine

  • Fluorescent substrate analogs with real-time monitoring

  • LC-MS/MS quantification of substrate concentrations in culture supernatants

  • Inside-out membrane vesicle assays for direct measurement of transport kinetics

  • Whole-cell assays comparing wild-type vs. eamB knockout strains

These methods parallel approaches used for characterizing other membrane transporters in S. typhimurium, though they would need to be adapted specifically for cysteine/O-acetylserine substrates .

How does eamB function compare with other efflux systems in S. typhimurium?

Comparative analysis should include:

  • Substrate profiling using a panel of potential molecules

  • Competition assays to determine substrate specificity

  • Inhibitor sensitivity studies

  • Expression profiling under identical conditions

  • Phylogenetic analysis with related transporters

OmpD in S. typhimurium serves as a useful comparison point, as it functions in the efflux of toxic compounds generated during infection, facilitating bacterial survival . Methodologically, similar approaches used to characterize OmpD function can be adapted for eamB characterization.

What is the contribution of eamB to S. typhimurium survival under stress conditions?

Assessment requires multiple stress models:

Stress ConditionMeasurement ParametersComparison Groups
Oxidative stress (H₂O₂)Growth curves, survival percentagesWild-type vs. ΔeamB
Bile acid exposureMIC determinationComplemented vs. knockout strains
Antimicrobial peptidesTime-kill assaysGene expression correlation
pH stressIntracellular pH measurementProtein activity correlation
Nutritional limitationMetabolomic profilingMultiple strain comparison

Similar stress response studies have been conducted for OmpA and OmpD proteins, showing their importance in bacterial adaptation to hostile environments .

What expression systems yield properly folded recombinant eamB suitable for structural studies?

For structural studies, expression system selection is critical:

  • E. coli-based systems (BL21, C41/C43) with specialized vectors for membrane proteins

  • Cell-free expression systems using detergent micelles

  • Yeast systems (P. pastoris) for eukaryotic-like folding environments

  • Native expression with purification tags in S. typhimurium

Key considerations include maintaining the native structure of transmembrane domains and proper insertion into membranes. OmpA structural studies have utilized similar expression strategies, with successful purification of stable protein suitable for crystallography or NMR studies .

What detergents and stabilization strategies are most effective for maintaining eamB native conformation?

Detergent screening should include:

Detergent ClassExamplesAssessment Methods
Non-ionicDDM, OG, Triton X-100Circular dichroism
ZwitterionicLDAO, CHAPSThermostability assays
PolymersAmphipols, nanodiscsSize-exclusion chromatography
Mixed micellesDDM/CHS combinationsFunctional assays
Lipid-basedBicelles, liposomesElectron microscopy

For OmpA and other outer membrane proteins of S. typhimurium, detergent selection has proven critical for maintaining native β-barrel structure during purification and analysis .

How can computational approaches complement experimental structural studies of eamB?

Computational approaches include:

  • Homology modeling based on structurally characterized transporters

  • Molecular dynamics simulations of eamB in membrane environments

  • Docking studies with potential substrates and inhibitors

  • Prediction of critical residues for substrate binding and transport

  • Evolutionary analysis to identify conserved functional domains

These in silico approaches can guide experimental design and interpretation, similar to structural studies of OmpA that have identified immunogenic domains and functional regions .

Does recombinant eamB elicit specific immune responses in infection models?

Assessment of immune responses should include:

  • Analysis of T-cell responses (CD4+ and CD8+) to recombinant eamB using flow cytometry

  • ELISPOT assays to quantify interferon-gamma producing cells

  • Cytokine profiling (IL-6, IL-17, IL-23, TNF-α) following eamB stimulation

  • Antibody response measurement (IgG, IgA) against purified eamB

Studies with OmpA demonstrated significant CD8+ T-cell responses in patients with reactive arthritis, with increased production of pro-inflammatory cytokines . Similar methodologies could be applied to investigate eamB immunogenicity.

How does the immune response to eamB compare with responses to other S. typhimurium outer membrane proteins?

Comparative immunological analysis should include:

Immune ParametereamB vs. OmpAeamB vs. OmpDAssessment Method
T-cell proliferationTo be determinedTo be determinedFlow cytometry (CD69+IFN-γ+)
Cytokine productionTo be determinedTo be determinedELISA, cytometric bead array
Antibody titersTo be determinedTo be determinedELISA, Western blot
Cross-reactivityTo be determinedTo be determinedAbsorption studies
Memory responseTo be determinedTo be determinedRecall assays

Studies with OmpA and OmpD revealed differential immune responses, with OmpA eliciting stronger CD8+ T cell responses compared to OmpD in patients with reactive arthritis . Similar comparative approaches would be valuable for positioning eamB in the immunological landscape of S. typhimurium antigens.

What is the potential of recombinant eamB as a vaccine component?

Assessment as a vaccine candidate requires:

  • Stability studies under various storage conditions (comparable to eBeam-based immune modulators that remain stable at room temperature)

  • Immunogenicity testing in animal models

  • Protection assessment against virulent S. typhimurium challenge

  • Adjuvant optimization studies

  • Safety profile determination

Electron beam-inactivated S. Typhimurium has shown promise as a vaccine candidate, retaining immunogenicity while ensuring safety . Similar inactivation approaches could be explored for eamB-based vaccine formulations.

How does eamB expression change during different phases of S. typhimurium infection?

Investigating expression dynamics requires:

  • In vitro infection models using relevant cell lines (macrophages, epithelial cells)

  • qRT-PCR analysis of eamB expression at different time points post-infection

  • Reporter constructs (GFP/luciferase fusions) for real-time monitoring

  • In vivo infection models with tissue-specific expression analysis

  • Single-cell analysis techniques to assess expression heterogeneity

OmpA expression has been shown to vary during infection and plays a role in bacterial invasion of mammalian cells . Similar temporal expression studies for eamB would provide insights into its role during different infection stages.

What regulatory networks control eamB expression in response to environmental cues?

Regulatory network analysis should include:

  • Promoter mapping and transcription start site identification

  • Transcription factor binding site prediction and validation

  • Chromatin immunoprecipitation studies for key regulators

  • Construction of reporter fusions to assess regulatory inputs

  • Analysis of expression in regulatory gene knockout backgrounds

Studies of OmpA regulation have revealed complex control mechanisms responding to environmental stresses . Similar approaches would uncover the regulatory landscape governing eamB expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.