Recombinant Salmonella typhimurium Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
rsxE; STM1454; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that couples electron transfer with translocation of ions across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links

KEGG: stm:STM1454

STRING: 99287.STM1454

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Rnf complex and what role does RnfE play within it?

The Rnf complex is a membrane-bound enzyme widely distributed among bacteria that functions as a respiratory enzyme, oxidizing reduced ferredoxin and reducing NAD+ (and vice versa), coupled to ion transport across the cytoplasmic membrane. This complex is critically important in many bacteria for energy conservation and for driving ferredoxin reduction through reverse electron transport .

Within this complex, RnfE serves as one of the two membrane-integral subunits (alongside RnfD) that are suggested to mediate ion (specifically Na+) transport. This transport is driven by electron flow that involves iron-sulfur clusters, monovalent iron, and covalently bound flavins . In Salmonella typhimurium, RnfE contributes to the establishment of ion gradients across the membrane, which can be harnessed for ATP synthesis through a Na+-F1F0 ATP synthase, forming a simple, two-limb respiratory chain.

How can I confirm successful expression of recombinant Salmonella typhimurium RnfE protein?

Confirmation of recombinant Salmonella typhimurium RnfE expression requires a multifaceted approach:

  • DNA-level verification: Use PCR amplification with primers specific to the rnfE gene, followed by sequence verification to confirm correct insertion into your expression vector.

  • Protein expression analysis: Employ Western blotting with antibodies specific to either RnfE or to an epitope tag incorporated into your recombinant construct. For membrane proteins like RnfE, ensure proper membrane fraction isolation during sample preparation.

  • Functional verification: Since RnfE is part of a Na+ transporting complex, functional assays measuring Na+ transport in membrane vesicles can provide evidence of proper folding and integration into membranes.

  • Colony PCR screening: For rapid screening of bacterial colonies, colony PCR can be performed using primers that bind to the rnfE gene, similar to techniques used for confirming Salmonella colonies in diagnostic assays .

When expressing membrane proteins like RnfE, optimization of growth conditions (temperature, inducer concentration, and timing) is often crucial to avoid formation of inclusion bodies.

What are the optimal conditions for purifying recombinant Salmonella typhimurium RnfE protein?

Purification of recombinant Salmonella typhimurium RnfE requires specialized protocols for membrane proteins:

  • Membrane extraction: Begin with gentle cell lysis methods (such as enzymatic lysis or French press) followed by differential centrifugation to isolate membrane fractions.

  • Detergent selection: Screen multiple detergents (e.g., n-dodecyl-β-D-maltoside, digitonin, or Triton X-100) for optimal solubilization of RnfE from membranes while maintaining protein stability and function.

  • Affinity chromatography: If your recombinant RnfE contains an affinity tag (His, FLAG, etc.), use appropriate affinity chromatography as an initial purification step.

  • Size exclusion chromatography: Follow with size exclusion chromatography to separate properly folded protein from aggregates and to exchange detergents if needed.

  • Activity preservation: Throughout the purification process, maintain buffers with appropriate ionic strength, pH (typically near physiological), and consider including stabilizing agents such as glycerol or specific lipids.

The success in purifying active RnfE often depends on preserving the native lipid environment or reconstituting the protein into suitable lipid environments after purification, as has been demonstrated for other components of respiratory complexes .

How can I investigate Na+ transport activity of the recombinant Salmonella typhimurium RnfE within the complete Rnf complex?

Investigating Na+ transport activity of recombinant Salmonella RnfE requires reconstitution of the complete Rnf complex and specialized transport assays:

  • Co-expression system: Establish a system for co-expressing all six Rnf subunits (RnfA, RnfB, RnfC, RnfD, RnfE, and RnfG) in appropriate stoichiometry. This might involve a polycistronic expression system or multiple compatible plasmids.

  • Proteoliposome reconstitution: After purification of the complete complex, reconstitute it into proteoliposomes with defined lipid composition. Control the orientation of the complex by the reconstitution method.

  • Na+ transport measurement:

    • Direct measurement: Use Na+-sensitive fluorescent dyes (e.g., SBFI) entrapped in proteoliposomes to monitor Na+ influx

    • Indirect measurement: Monitor membrane potential changes using voltage-sensitive dyes

    • Radioisotope flux: Measure 22Na+ uptake into proteoliposomes

  • Activity coupling: Assess coupling between electron transport and Na+ translocation by initiating electron flow through the addition of reduced ferredoxin and NAD+, similar to experiments performed with the Rnf complex from Thermotoga maritima .

  • Mutational analysis: Create site-directed mutations in conserved residues of RnfE predicted to be involved in Na+ binding or translocation, and measure the impact on transport activity.

These methods can be adapted from approaches used to characterize the related respiratory Na+ pump from Thermotoga maritima, which was demonstrated to function as a primary Na+ pump coupled to a Na+-F1F0 ATP synthase .

What experimental approaches can distinguish the specific contribution of RnfE from other Rnf complex components in electron transport?

Distinguishing RnfE's specific contribution within the Rnf complex requires targeted experimental strategies:

  • Subunit-selective mutagenesis:

    • Create point mutations in conserved residues unique to RnfE

    • Engineer chimeric proteins swapping domains between RnfE and RnfD (the other membrane-integral subunit)

    • Assess impacts on electron transport and ion translocation activities

  • Cross-linking studies:

    • Use chemical cross-linkers with various spacer lengths to identify proximity relationships

    • Perform site-directed cross-linking using engineered cysteine residues to map interaction surfaces

    • Analyze cross-linked products by mass spectrometry to identify interaction partners

  • Spectroscopic analysis:

    • Use EPR spectroscopy to monitor iron-sulfur cluster reduction states during electron transport

    • Apply FTIR difference spectroscopy to detect conformational changes in RnfE during the catalytic cycle

    • Implement fluorescence resonance energy transfer (FRET) between labeled components to monitor protein-protein interactions

  • Partial complex reconstitution:

    • Express and purify subcomplexes with and without RnfE

    • Compare electron transport activities and coupling efficiencies

    • Determine if RnfE is essential for complex assembly or stability

  • Protein-specific inhibitors:

    • Develop antibodies or nanobodies that specifically bind to exposed regions of RnfE

    • Assess the impact of these binding agents on various activities of the complex

These approaches can help delineate whether RnfE primarily functions in Na+ transport, electron transfer, or structural organization of the complex, building on structural insights suggested from studies of related respiratory complexes .

How does the structure-function relationship of Salmonella typhimurium RnfE compare with RnfE homologs in other bacterial species?

The structure-function comparison of Salmonella typhimurium RnfE with homologs across bacterial species requires multi-level analysis:

  • Sequence analysis and conservation mapping:

    • Perform multiple sequence alignment of RnfE homologs across diverse bacterial species

    • Identify highly conserved regions likely essential for function

    • Map conservation onto predicted structural models

    • Analyze co-evolution patterns to predict functional coupling between residues

  • Structural comparison:

    • Generate homology models based on related proteins with known structures

    • Compare predicted transmembrane topology and potential ion-conducting channels

    • Identify potential Na+ binding sites based on conserved charged or polar residues

    • Compare these models with studies on the Rnf complex from Thermotoga maritima

  • Functional complementation:

    • Test whether RnfE from different species can functionally replace Salmonella RnfE

    • Measure restoration of electron transport and Na+ pumping activities

    • Create chimeric proteins with domains from different species to map functional regions

  • Evolutionary adaptation analysis:

    • Compare RnfE sequences from bacteria adapted to different environments (thermophiles, halophiles, etc.)

    • Correlate sequence variations with environmental adaptations

    • Test whether these variations affect optimal conditions for enzyme activity

  • Cross-species functional assays:

    • Compare biochemical properties (substrate specificity, ion selectivity, kinetic parameters)

    • Assess tolerance to environmental stressors (temperature, pH, salt concentration)

    • Evaluate potential differences in regulatory mechanisms

This comparative approach can reveal whether functional differences exist between RnfE homologs that might reflect adaptation to different ecological niches or metabolic strategies, similar to adaptations observed in the well-characterized Rnf complex of Thermotoga maritima .

What methodologies are most effective for studying the interaction between RnfE and other components of the electron transport chain in Salmonella typhimurium?

To effectively study interactions between RnfE and other electron transport components in Salmonella typhimurium, researchers should consider the following methodologies:

  • Membrane protein co-purification:

    • Implement tandem affinity purification using differentially tagged proteins

    • Apply gentle solubilization conditions to maintain native protein-protein interactions

    • Analyze co-purifying proteins by mass spectrometry to identify stable interaction partners

  • In vivo crosslinking coupled with mass spectrometry:

    • Utilize photo-activatable or chemical crosslinkers in living cells

    • Identify crosslinked peptides using specialized mass spectrometry workflows

    • Map interaction interfaces at amino acid resolution

  • Native electrophoresis techniques:

    • Employ Blue Native PAGE to separate intact membrane protein complexes

    • Use two-dimensional native/SDS-PAGE to resolve complex components

    • Apply in-gel activity assays to correlate complex composition with function

  • Proximity labeling approaches:

    • Fuse RnfE to enzymes like BioID or APEX2 that modify nearby proteins

    • Identify labeled proteins to map the proximal interactome

    • Compare interactomes under different metabolic conditions

  • Electron microscopy and structural studies:

    • Use negative stain or cryo-electron microscopy to visualize purified complexes

    • Apply single-particle analysis to determine structure

    • Implement gold-labeled antibodies to locate specific subunits within complexes

  • Functional reconstitution assays:

    • Reconstitute purified components into liposomes in defined combinations

    • Measure electron transport and ion translocation activities

    • Determine the minimal components required for various activities

These approaches can build on existing knowledge of respiratory enzymes like the Rnf complex, which has been characterized as coupling electron transfer to Na+ transport, potentially working alongside a Na+-F1F0 ATP synthase to form a simple respiratory chain .

How can I design appropriate controls for experiments investigating RnfE function in Salmonella typhimurium?

Designing appropriate controls for RnfE functional studies requires careful consideration of multiple experimental variables:

  • Genetic controls:

    • Deletion mutant: Use a ΔrnfE strain as a negative control

    • Complemented strain: Reintroduce wild-type rnfE on a plasmid to confirm phenotype restoration

    • Point mutant controls: Compare with strains harboring mutations in conserved residues

    • Related gene deletions: Compare with mutations in other Rnf complex components

  • Protein expression controls:

    • Empty vector control: Express the same vector backbone without the rnfE insert

    • Inactive variants: Express catalytically inactive RnfE mutants

    • Expression level normalization: Use Western blotting to confirm comparable expression levels

    • Subcellular localization: Confirm proper membrane integration of wild-type and mutant proteins

  • Functional assay controls:

    • No substrate control: Measure background activity without electron donors/acceptors

    • Ionophore controls: Use specific Na+ ionophores to dissipate Na+ gradients

    • Inhibitor controls: Apply specific inhibitors of related respiratory enzymes

    • Alternative substrate control: Test specificity by offering alternative electron donors/acceptors

  • Purification and reconstitution controls:

    • Protein-free liposomes: Prepare liposomes without protein to measure background leakage

    • Denatured protein control: Heat-inactivate proteins before reconstitution

    • Random orientation control: Compare with protocols yielding random vs. controlled protein orientation

    • Detergent controls: Ensure residual detergent isn't causing membrane effects

These controls should be systematically implemented based on experimental design principles similar to those used in studies of other components of bacterial respiratory chains, such as the verified Na+-coupled Rnf complex from Thermotoga maritima .

What are the key considerations for designing site-directed mutagenesis experiments to study critical residues in Salmonella typhimurium RnfE?

Designing effective site-directed mutagenesis experiments for Salmonella typhimurium RnfE requires strategic consideration of the following factors:

  • Target residue selection:

    • Focus on highly conserved residues identified through multiple sequence alignments

    • Prioritize charged residues (Asp, Glu, Lys, Arg) in transmembrane regions as potential ion-conducting residues

    • Target residues predicted to be at interfaces with other Rnf subunits

    • Consider residues in predicted cofactor binding sites (for iron-sulfur clusters or flavins)

  • Substitution strategy:

    • Conservative substitutions: Replace with amino acids of similar properties to test specific chemical requirements

    • Charge inversions: Substitute positive for negative residues to test electrostatic requirements

    • Size variations: Test spatial constraints by varying side chain bulk

    • Cysteine scanning: Systematically replace residues with cysteine for subsequent modification

  • Functional assessment plan:

    • Design assays that specifically test Na+ transport (e.g., Na+-dependent growth or direct Na+ uptake measurements)

    • Implement electron transport assays to distinguish between ion transport and electron transfer defects

    • Assess protein stability and complex assembly to identify structural vs. catalytic residues

    • Consider complementation tests in ΔrnfE strains to confirm in vivo relevance

  • Structural context:

    • Generate homology models based on related proteins to predict structural impact of mutations

    • Consider developing a series of mutations along predicted ion channels or electron transfer pathways

    • Design double mutants to test coupled functions between residues

  • Data interpretation framework:

    • Establish clear criteria for categorizing mutations (assembly defects, catalysis defects, coupling defects)

    • Consider quantitative structure-function relationships by measuring activity across a range of mutations

    • Plan statistical approaches for analyzing potentially subtle phenotypic effects

This approach aligns with current understanding of membrane-integral subunits like RnfE and RnfD, which are thought to mediate ion transport driven by electron transport involving iron-sulfur clusters, monovalent iron, and flavins .

How should I analyze and interpret contradictory data regarding RnfE function in different experimental systems?

When faced with contradictory data regarding RnfE function across different experimental systems, apply these systematic analysis and interpretation approaches:

  • System-specific variable identification:

    • Create a comprehensive table comparing all experimental conditions across systems

    • Systematically evaluate differences in expression systems, genetic backgrounds, media composition, and growth conditions

    • Assess potential differences in post-translational modifications or protein interaction partners

    • Consider the impact of different detergents or lipid environments on membrane protein function

  • Methodological reconciliation:

    • Examine assay sensitivity and specificity limitations

    • Consider whether different methods are measuring different aspects of RnfE function

    • Evaluate whether indirect vs. direct measurement approaches could explain differences

    • Standardize protocols across systems where possible to eliminate methodological variables

  • Statistical and reproducibility assessment:

    • Apply appropriate statistical tests to determine if differences are statistically significant

    • Evaluate sample sizes and power calculations across studies

    • Implement blind analysis procedures to minimize experimenter bias

    • Consider reproducibility across independent biological replicates and laboratories

  • Hierarchical hypothesis testing:

    • Develop testable hypotheses that could explain observed contradictions

    • Design experiments specifically targeting these contradictions

    • Consider whether apparent contradictions reflect different aspects of a more complex function

    • Test whether environmental conditions modulate RnfE function in a way that explains discrepancies

  • Integration with wider literature:

    • Compare findings with related systems (other Rnf complexes, similar ion-transporting complexes)

    • Consider evolutionary context - could differences reflect adaptive specialization?

    • Evaluate whether the contradictions align with known regulatory mechanisms

    • Review literature on similar membrane proteins for potential analogous situations

This structured approach recognizes that proteins like RnfE can have context-dependent functions, similar to the differential behavior observed in the well-studied Rnf complex which has been shown to function primarily as a Na+ pump in some organisms .

What statistical approaches are most appropriate for analyzing the impact of mutations in RnfE on electron transport and Na+ translocation activities?

When analyzing the impact of RnfE mutations on electron transport and Na+ translocation, these statistical approaches are most appropriate:

  • Activity correlation analysis:

    • Calculate Pearson or Spearman correlation coefficients between electron transport and Na+ translocation activities

    • Test whether mutations disrupt the coupling between these activities

    • Construct scatter plots with regression analysis to visualize coupling relationships

    • Use Z-score normalization to compare effects across different activity scales

  • Multivariate analysis for multiple parameters:

    • Apply principal component analysis (PCA) to identify major sources of variation across multiple parameters

    • Use hierarchical clustering to group mutations with similar functional profiles

    • Implement discriminant analysis to identify measurements that best distinguish different mutation classes

    • Consider partial least squares regression for relating structural parameters to functional outcomes

  • Dose-response modeling:

    • Fit activity data to appropriate enzyme kinetic models (Michaelis-Menten, Hill equation)

    • Compare kinetic parameters (Km, Vmax, Hill coefficient) across mutants using extra sum-of-squares F test

    • Analyze changes in substrate affinity vs. catalytic efficiency to distinguish binding from catalytic effects

    • Apply global fitting approaches to model complex kinetic mechanisms

  • Time series and transporter kinetics:

    • Use exponential or bi-exponential fitting for ion transport progress curves

    • Analyze initial rates and steady-state levels to distinguish effects on transport rate vs. capacity

    • Apply appropriate transporter kinetic models (alternating access models, channel models)

    • Consider compartmental modeling for complex systems with multiple ion pools

  • Statistical significance testing framework:

    • Use one-way ANOVA with appropriate post-hoc tests for comparing multiple mutants to wild-type

    • Apply false discovery rate correction for multiple hypothesis testing

    • Consider multifactorial ANOVA when testing interactions between mutations and environmental conditions

    • Implement bootstrap or permutation tests for non-normally distributed data

These approaches can be used to analyze data similar to those obtained in studies of the Rnf complex, which couples electron transport to Na+ translocation across the membrane .

What are the most promising future research directions for understanding RnfE's role in bacterial energy metabolism?

The most promising future research directions for understanding RnfE's role in bacterial energy metabolism include:

  • High-resolution structural studies:

    • Determine the atomic structure of the complete Rnf complex using cryo-electron microscopy

    • Map the location and arrangement of RnfE within the complex

    • Identify ion channels, binding sites, and conformational changes during the catalytic cycle

    • Compare structures in different functional states to establish a mechanistic model

  • Integrative systems biology approaches:

    • Apply metabolic flux analysis to quantify the contribution of the Rnf complex to cellular energy budget

    • Develop genome-scale metabolic models incorporating Rnf activity under different growth conditions

    • Use synthetic biology approaches to rewire electron flow through engineered Rnf variants

    • Study regulatory networks controlling rnf gene expression in response to environmental conditions

  • Comparative studies across bacterial species:

    • Systematically compare the function and regulation of Rnf complexes across diverse bacterial phyla

    • Investigate adaptation of RnfE structure and function in extremophiles

    • Explore potential roles beyond energy metabolism, such as in redox homeostasis or stress response

    • Examine evolutionary patterns in Rnf complex composition and function

  • Therapeutic and biotechnological applications:

    • Evaluate the Rnf complex as a potential antimicrobial target in pathogenic bacteria

    • Explore engineering of Rnf complexes for improved bioenergy applications

    • Investigate the role of the Rnf complex in bacterial pathogenesis and host colonization

    • Develop biosensors based on Rnf activity for monitoring cellular energy status

  • Integration with emerging technologies:

    • Apply single-molecule techniques to study real-time activity of individual Rnf complexes

    • Develop in vivo sensors to monitor Rnf activity in living cells

    • Use computational approaches to model ion and electron transport mechanisms

    • Implement optogenetic control of Rnf activity for precise temporal manipulation

These directions build upon current understanding of the Rnf complex as a Na+-coupled respiratory enzyme that, together with a Na+-F1F0 ATP synthase, can form a simple respiratory chain in bacteria like Thermotoga maritima , with potential parallels in Salmonella typhimurium.

How might understanding RnfE function in Salmonella typhimurium contribute to broader bacterial physiology and potential antimicrobial development?

Understanding RnfE function in Salmonella typhimurium has significant implications for bacterial physiology and antimicrobial development:

  • Metabolic versatility and adaptation:

    • Clarify how the Rnf complex contributes to Salmonella's ability to thrive in diverse host environments

    • Understand how modulation of energy metabolism supports survival under nutrient limitation

    • Elucidate the role of RnfE in anaerobic respiration during host colonization

    • Determine if the Rnf complex provides metabolic advantages during competition with host microbiota

  • Pathogenesis and virulence mechanisms:

    • Investigate whether Rnf-mediated energy conservation supports virulence factor production

    • Examine the potential role of Rnf in surviving host-induced oxidative or nitrosative stress

    • Determine if Rnf activity influences intracellular survival within host cells

    • Study how metabolic flexibility enabled by Rnf affects tissue tropism and systemic spread

  • Antimicrobial target assessment:

    • Evaluate RnfE as a potential drug target based on essentiality under infection-relevant conditions

    • Develop high-throughput screening assays for inhibitors of Rnf complex activity

    • Design structure-based approaches to identify molecules that disrupt RnfE function

    • Assess potential for narrow vs. broad-spectrum targeting of bacterial Rnf complexes

  • Resistance mechanism insights:

    • Explore whether Rnf activity contributes to tolerance against existing antibiotics

    • Investigate potential connections between energy metabolism and persister cell formation

    • Understand how metabolic adaptation through Rnf might support survival during antibiotic exposure

    • Examine evolutionary constraints on Rnf that might limit resistance development

  • Diagnostic and detection applications:

    • Develop molecular detection methods for Salmonella based on rnfE sequences, building on existing detection methodologies

    • Create activity-based probes specific for Rnf complex function

    • Explore potential biomarkers related to Rnf activity for diagnostic applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.