Recombinant Salmonella typhimurium Flagellar biosynthetic protein flhB (flhB)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Flagellar Biosynthesis

FlhB participates in two critical processes:

Substrate Specificity Switching

  • FlhB, alongside FliK, regulates the transition from exporting rod/hook-type proteins (e.g., FlgB, FlgD) to filament-type proteins (e.g., FliC) .

  • Autocleavage of FlhB is necessary for this switch . Mutations (e.g., N269A) lock the system in rod/hook export mode .

Protein Export Machinery

  • FlhB forms part of the flagellar T3SS with FlhA, FliO, FliP, FliQ, and FliR .

  • Localized in the cytoplasmic membrane, FlhB facilitates interactions with cytoplasmic ATPases (FliH, FliI) for substrate recognition .

Expression and Purification

  • Overproduction: Truncated FlhB variants (e.g., N-terminally His-tagged FlhB-C) have been overexpressed in E. coli for structural studies .

  • Purification: Affinity chromatography and gel filtration yield soluble FlhB-C fragments for crystallography .

Key Mutational Analyses

MutationEffect on FlhB FunctionSource
N269ABlocks autocleavage; locks export in rod/hook mode
ΔPRR (residues 361–371)Reduces autocleavage efficiency; impairs hook/filament assembly
Y376ANo effect on autocleavage; maintains wild-type motility
L344EPermits secretion of mutant substrates (e.g., FlgB-F45R) but reduces wild-type secretion

Genetic and Phenotypic Interactions

  • Suppressor Mutations: Chimeric FlhB proteins (e.g., Salmonella-Aquifex hybrids) restore partial motility via mutations (e.g., V259E, ΔKG288–289) that destabilize FlhB-C, enhancing conformational flexibility .

  • Transcriptional Regulation: Deletion of flhB abolishes flagellin (FlaA) expression and downregulates fliM, fliY, and fliI in Listeria monocytogenes, highlighting its regulatory role beyond secretion .

Applications and Implications

  • Drug Targeting: FlhB’s role in virulence-associated T3SS makes it a potential target for anti-motility therapeutics .

  • Biotechnological Tools: Engineered FlhB variants (e.g., L344E) enable selective secretion of modified substrates for synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
flhB; STM1914; Flagellar biosynthetic protein FlhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
flhB
Target Protein Sequence
MAEESDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAGM LSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSGKS LQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAESPI VAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDPHV KGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIALR IREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWRLAGGQR PPQPENLPVPEALDFMNEKNTDG
Uniprot No.

Target Background

Function
FlhB is essential for the formation of the rod structure within the basal body of the flagellar apparatus. In conjunction with FliI and FliH, it may constitute the export apparatus for flagellin.
Gene References Into Functions
  1. Data indicates that full-length membrane protein FlhB, purified under solubilizing, non-denaturing conditions, forms a stable dimer through its transmembrane domain and binds stably to flagellar protein FliH. PMID: 26244937
  2. Conformational flexibility may be crucial for FlhB function. PMID: 23874605
  3. Crystals of FlhB diffracted to 2.45 Å resolution and belonged to space group P4(2)2(1)2, with unit-cell parameters a=b=49.06, c=142.94 Å PMID: 21795800
  4. FlhB cleavage is an autocatalytic process PMID: 16246842
Database Links

KEGG: stm:STM1914

STRING: 99287.STM1914

Protein Families
Type III secretion exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and cellular localization of the FlhB protein in Salmonella typhimurium?

FlhB is a 383-amino-acid integral membrane protein with a calculated molecular mass of 42,322 Da. The protein is highly hydrophobic with several potential membrane-spanning segments, confirming its role as an integral membrane component. Localization studies using antibodies against N-terminally truncated FlhB proteins and Western blotting with fractionated cell extracts have definitively shown that FlhB localizes to the cytoplasmic membrane . This membrane localization is critical for its function in the flagellar export apparatus. The protein contains distinct domains: an N-terminal transmembrane domain (FlhBTM) and a C-terminal cytoplasmic domain (FlhBC), which can be further divided into FlhBCN and FlhBCC following autocleavage at Pro-270 .

What is the basic function of FlhB in flagellar assembly?

FlhB serves as a central component of the type III flagellar export apparatus and plays dual critical roles in flagellar morphogenesis:

  • It is required for the formation of the rod structure of the flagellar apparatus, participating in early basal body assembly .

  • It functions as a substrate specificity switch that, in conjunction with the hook-length control protein FliK, mediates the transition from rod- and hook-type substrate export to filament-type substrate export during flagellar assembly .

The protein's ability to regulate this export specificity switch is fundamental to proper flagellar formation, as it ensures the sequential and orderly assembly of flagellar components from the cell-proximal structures to the cell-distal ones .

How does the autocleavage of FlhB contribute to its function?

Wild-type FlhBC undergoes specific autocleavage at Pro-270, resulting in two polypeptides, FlhBCN and FlhBCC, with a relatively short half-life of approximately 5 minutes. These cleaved polypeptides retain the ability to interact with each other after cleavage . This autocleavage appears to be functionally significant:

  • Experimental coproduction of the cleavage products (FlhBΔCC and FlhBCC) can restore both motility and flagellar protein export in an flhB mutant host, indicating that the polypeptides can form productive associations even after cleavage.

  • The cleavage products, existing as a FlhBCN-FlhBCC complex, demonstrate differential binding affinities for export substrates, with stronger binding to rod- and hook-type substrate FlgD compared to the filament-type substrate FliC .

This suggests that the conformational change mediated by the interaction between FlhBCN and FlhBCC is responsible for the substrate specificity switching process, a critical function in ordered flagellar assembly.

What are the established methods for purifying recombinant FlhB protein for in vitro studies?

Methodological Approach:

  • Construct Design: For effective purification, N-terminally truncated FlhB proteins are typically used, focusing on the cytoplasmic domain (FlhBC) to avoid the challenges associated with purifying hydrophobic membrane proteins .

  • Expression System: The gene encoding the cytoplasmic domain of FlhB can be cloned into expression vectors like pET-series vectors, allowing for IPTG-inducible expression in E. coli BL21(DE3) or similar strains.

  • Purification Protocol:

    • Initial cell lysis using sonication or French press in appropriate buffer systems

    • Clarification of lysate by centrifugation (typically 15,000 × g for 30 minutes)

    • Affinity chromatography using His-tag or other fusion tags

    • Size-exclusion chromatography for further purification

    • Concentration determination using Bradford assay or absorbance at 280 nm

  • Verification: SDS-PAGE analysis and Western blotting with anti-FlhB antibodies to confirm purity and identity .

For functional studies, it's important to note that the isolated FlhBC domain can exist in distinct forms: the intact form or the cleaved FlhBCN-FlhBCC complex, each with potentially different substrate binding properties .

What genetic approaches are effective for studying FlhB function in vivo?

Several genetic manipulation techniques have proven valuable for investigating FlhB function:

  • Gene Deletion and Complementation:

    • Construction of flhB deletion mutants using allelic exchange methods

    • Complementation with wild-type or mutant flhB alleles on plasmids

    • Analysis of resulting phenotypes regarding motility and flagellar structure

  • Site-Directed Mutagenesis:

    • Introduction of specific mutations, particularly in the C-terminal domain

    • Analysis of autocleavage-resistant mutants (half-lives of 20-60 minutes compared to wild-type's 5 minutes)

    • Identification of suppressor mutations that can bypass FliK requirements

  • Suppressor Screening:

    • Isolation of motile revertants from fliK mutant backgrounds

    • Mapping of suppressor mutations to the flhB gene

    • Sequence analysis of suppressor mutations, which are typically located near the 3'-end of the flhB gene

  • Allele Exchange:

    • Introduction of kanamycin-resistant gene cartridges or other markers

    • Construction of flhB variants with altered cleavage properties

    • Analysis of resulting flagellar phenotypes

These genetic approaches have been instrumental in defining the role of FlhB in substrate specificity switching and flagellar assembly.

What microscopy techniques are most informative for visualizing FlhB localization and function?

Key Microscopy Approaches:

  • Electron Microscopy:

    • Negative staining of fractionated flagellar structures

    • Analysis of polyhook versus polyhook-filament complexes in various genetic backgrounds

    • Examination of flagellar morphology in wild-type versus flhB and fliK mutants

  • Immunofluorescence Microscopy:

    • Antibody labeling of FlhB in fixed cells

    • Co-localization with other flagellar basal body components

    • Visualization of FlhB distribution within the cell membrane

  • FRET or BiFC Analysis:

    • Fusion of fluorescent protein tags to FlhB and potential interaction partners

    • In vivo visualization of protein-protein interactions

    • Examination of conformational changes during autocleavage

  • Cryo-Electron Microscopy:

    • High-resolution structural analysis of the flagellar export apparatus

    • Localization of FlhB within the basal body complex

    • Visualization of conformational changes during substrate switching

These techniques, when combined with biochemical and genetic approaches, provide a comprehensive understanding of FlhB localization, interactions, and function in flagellar assembly.

How does FlhB coordinate with FliK to regulate hook length and substrate specificity switching?

FlhB and FliK participate in a sophisticated molecular mechanism that controls hook length and mediates the substrate specificity switch during flagellar assembly:

  • Normal Function:

    • FliK functions as a molecular ruler that measures hook length

    • When the hook reaches appropriate length (~55 nm), FliK interacts with FlhB

    • This interaction triggers a conformational change in FlhB

    • FlhB switches from exporting rod/hook-type substrates to filament-type substrates

  • In fliK Mutants:

    • Without FliK, the specificity switch fails to occur

    • Cells continue to produce hook proteins, resulting in abnormally elongated hooks (polyhooks)

    • Filament assembly is not initiated, leading to non-functional flagella

  • Suppressor Mutations in flhB:

    • Specific mutations near the 3'-end of the flhB gene can restore flagellar assembly in fliK mutants

    • These mutant FlhB proteins can undergo substrate specificity switching without requiring FliK

    • They produce polyhook-filament complexes even in a fliK mutant background

    • These suppressor mutants exhibit increased resistance to autocleavage (half-lives of 20-60 minutes compared to wild-type's 5 minutes)

This suggests that FliK normally induces a conformational change in FlhB, and the suppressor mutations in FlhB mimic this conformational state, allowing for substrate specificity switching even in the absence of FliK.

What protein-protein interactions are critical for FlhB function in the flagellar export apparatus?

FlhB engages in multiple protein-protein interactions that are essential for its role in flagellar assembly:

Interaction PartnerInteraction DomainFunctional SignificanceDetection Method
FlhATransmembrane domainsCo-function in flagellar export apparatusCo-immunoprecipitation
FliI/FliHFlhBC domainATPase complex of export apparatusAffinity blotting
FliKFlhBC domainHook length control and substrate switchingExport substrate interaction
FlgD (rod/hook substrate)FlhBCN-FlhBCC complexPreferential binding during early assemblyAffinity blotting
FliC (filament substrate)Intact FlhBC or FlhBCCRecognition after substrate switchingAffinity blotting

The FlhBCN-FlhBCC complex binds preferentially to rod- and hook-type substrates like FlgD, while the intact form of FlhBC or FlhBCC alone binds both rod/hook and filament substrates with similar affinity. Notably, FlhBCN by itself does not appreciably bind export substrates, indicating the importance of the complex formation or intact structure for substrate recognition .

These data support a model where conformational changes in FlhB, mediated by autocleavage and the interaction between FlhBCN and FlhBCC, control substrate specificity during flagellar assembly.

What is the current model for how FlhB functions in the type III secretion system of flagellar assembly?

The current model for FlhB function integrates its roles in early basal body assembly and substrate specificity switching:

  • Early Assembly Phase:

    • FlhB, along with FlhA, FliI, and FliH, constitutes the core export apparatus

    • This apparatus is embedded in the cytoplasmic membrane at the base of the nascent flagellum

    • FlhB participates in the export of rod and hook components

  • Switching Mechanism:

    • FlhB undergoes autocleavage at Pro-270, creating FlhBCN and FlhBCC

    • The cleaved polypeptides remain associated, forming a complex

    • This complex initially favors binding to rod/hook-type substrates

    • As hook assembly progresses, FliK interacts with FlhB

    • This interaction triggers a conformational change in the FlhBCN-FlhBCC complex

    • The conformational change alters binding specificity to favor filament-type substrates

  • Substrate Recognition and Export:

    • FlhB recognizes and binds specific export signals in flagellar proteins

    • The protein works in concert with the ATPase complex (FliI/FliH) to energize export

    • The conformational state of FlhB determines which substrates are recognized and exported

This model is supported by suppressor mutations in flhB that can bypass the requirement for FliK by mimicking the post-interaction conformational state, allowing filament assembly even in fliK mutants .

How do mutations in FlhB affect substrate specificity switching, and what does this reveal about the molecular mechanism?

Research on FlhB mutations has provided critical insights into the substrate specificity switching mechanism:

  • Autocleavage-Resistant Mutations:

    • Mutations that render FlhB resistant to autocleavage (half-lives of 20-60 minutes versus wild-type's 5 minutes) can still function in substrate specificity switching

    • These mutants can undergo switching even in the absence of FliK

    • This suggests that cleavage itself is not essential for the switching function

    • Rather, the conformational change that normally accompanies or follows cleavage appears to be the critical factor

  • FliK-Independent Suppressor Mutations:

    • Mutations near the 3'-end of the flhB gene can suppress fliK null mutations

    • These suppressors allow the formation of polyhook-filament complexes rather than just polyhooks

    • This indicates that these mutations lock FlhB in a conformation that permits filament protein export

    • The existence of these suppressors suggests that FliK normally acts by inducing a conformational change in FlhB

    • The suppressor mutations mimic this conformational state, bypassing the need for FliK

  • Domain-Specific Effects:

    • Mutations in different domains of FlhB have distinct effects on function

    • Alterations in the transmembrane domains affect membrane integration and export apparatus assembly

    • Mutations in the cytoplasmic domain primarily impact substrate recognition and specificity switching

    • These domain-specific effects highlight the modular nature of FlhB function

These findings collectively support a model where conformational flexibility in FlhB is central to its substrate switching function, with autocleavage potentially facilitating but not being absolutely required for this conformational change.

What are the comparative differences in FlhB function across different bacterial species, and what does this reveal about flagellar evolution?

FlhB functions have been studied across several bacterial species, revealing both conserved features and interesting variations:

  • Conserved Features:

    • The basic role of FlhB in flagellar export apparatus is conserved across motile bacteria

    • The domain structure featuring transmembrane and cytoplasmic regions is generally maintained

    • The substrate switching function appears to be a universal feature of FlhB homologs

  • Species-Specific Variations:

    • In Listeria monocytogenes, FlhB regulates the expression of flagellar proteins including FlaA, FliM, and FliY, suggesting an expanded regulatory role

    • Deletion of flhB in Listeria results in complete abolishment of FlaA expression and decreased expression of FliM and FliY

    • Different bacterial species show variations in the autocleavage mechanism and stability of FlhB

  • Evolutionary Implications:

    • The conservation of FlhB across diverse bacterial phyla suggests it was present in the common ancestor of flagellated bacteria

    • Variations in regulatory mechanisms may reflect adaptations to different ecological niches

    • The relationships between flagellar export systems and virulence-associated type III secretion systems suggest evolutionary connections between these structures

Comparative studies of FlhB across species provide valuable insights into both the essential conserved functions and the adaptable aspects of flagellar assembly mechanisms throughout bacterial evolution.

What experimental approaches can resolve the conformational changes in FlhB during substrate specificity switching?

Advanced experimental techniques that could elucidate the conformational dynamics of FlhB include:

These approaches, especially when used in combination, could provide a comprehensive understanding of the conformational switching mechanism that underlies FlhB function in flagellar assembly.

What are the common challenges in expressing and purifying functional FlhB protein, and how can they be overcome?

Researchers face several technical challenges when working with FlhB:

  • Membrane Protein Solubility Issues:

    • Challenge: Full-length FlhB is a hydrophobic membrane protein with multiple transmembrane segments.

    • Solution: Focus on the cytoplasmic domain (FlhBC) for many functional studies; alternatively, use specialized detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin for full-length protein extraction.

  • Protein Instability and Autocleavage:

    • Challenge: Wild-type FlhBC has a short half-life (~5 minutes) due to autocleavage at Pro-270.

    • Solution: Use autocleavage-resistant mutants for studies requiring stable protein; alternatively, purify freshly and maintain at lower temperatures to slow cleavage.

  • Conformational Heterogeneity:

    • Challenge: FlhB exists in multiple conformational states, complicating structural studies.

    • Solution: Use conformation-specific antibodies or nanobodies to stabilize specific states; employ SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) to separate conformational populations.

  • Functional Reconstitution:

    • Challenge: Reconstituting the complete export apparatus function in vitro is difficult.

    • Solution: Develop liposome-reconstitution systems that incorporate FlhB with other export apparatus components; use membrane scaffold proteins to create nanodiscs.

  • Co-expression Requirements:

    • Challenge: FlhB function may depend on interactions with other flagellar proteins.

    • Solution: Consider co-expression with relevant partners like FlhA or using polycistronic expression systems.

These approaches can significantly improve the success rate when working with this challenging but important flagellar protein.

How can researchers effectively distinguish between the different conformational states of FlhB in experimental settings?

Distinguishing between different conformational states of FlhB requires sophisticated experimental approaches:

  • Biochemical Differentiation:

    • SDS-PAGE under specific conditions to separate intact and cleaved forms

    • Limited proteolysis to identify exposed regions in different conformational states

    • Chemical crosslinking to capture specific interaction interfaces

  • Antibody-Based Methods:

    • Development of conformation-specific antibodies that recognize specific states

    • Epitope mapping to identify regions with altered exposure in different states

    • ELISA-based quantification of different conformational populations

  • Substrate Binding Assays:

    • Differential binding assays using rod/hook substrates (e.g., FlgD) versus filament substrates (e.g., FliC)

    • The FlhBCN-FlhBCC complex preferentially binds rod/hook-type substrates, while intact FlhBC or FlhBCC alone binds both substrate types similarly

    • Quantitative binding studies using surface plasmon resonance or microscale thermophoresis

  • Spectroscopic Methods:

    • Circular dichroism to detect secondary structure changes

    • Fluorescence spectroscopy with strategic labels to monitor conformational shifts

    • EPR spectroscopy with site-directed spin labeling to measure distances between domains

  • Functional Differentiation:

    • In vitro reconstitution of export using defined FlhB conformational states

    • Analysis of substrate export specificity as a functional readout of conformational state

These approaches can provide complementary information about the conformational landscape of FlhB during its functional cycle.

What are the potential applications of FlhB research beyond understanding bacterial motility?

FlhB research has implications that extend beyond basic flagellar biology:

  • Antimicrobial Drug Development:

    • FlhB is essential for bacterial motility, which contributes to virulence in many pathogens

    • Targeting FlhB could disrupt flagellar assembly and reduce bacterial virulence

    • Unlike many antibiotics, anti-motility drugs might reduce virulence without creating strong selective pressure for resistance

  • Biotechnology Applications:

    • Engineering the flagellar export system for protein secretion

    • Using modified FlhB proteins to control substrate specificity in biotechnological applications

    • Developing bacterial surface display systems based on flagellar assembly

  • Synthetic Biology:

    • Creating programmable molecular switches based on FlhB's ability to alternate between specificity states

    • Engineering bacterial sensors that use flagellar assembly as a reporter system

    • Developing minimal motility systems for synthetic cells

  • Evolutionary Biology:

    • Understanding the evolution of complex molecular machines

    • Exploring the relationship between flagellar export systems and virulence-associated type III secretion systems

    • Investigating the co-evolution of interacting proteins in multi-component assemblies

  • Nanotechnology:

    • Using principles from flagellar assembly to develop self-assembling nanostructures

    • Creating nanoscale molecular sorters based on the substrate specificity switching mechanism

These diverse applications highlight the broader impact of fundamental research on flagellar assembly components like FlhB.

What recent technological advances might accelerate our understanding of FlhB structure and function?

Several cutting-edge technologies are poised to advance FlhB research:

  • Structural Biology Innovations:

    • Cryo-electron tomography for visualizing FlhB in its native context within the bacterial cell

    • Microcrystal electron diffraction (MicroED) for structural determination from small crystals

    • Integrative structural biology approaches combining multiple data types

  • Advanced Imaging:

    • Super-resolution microscopy to visualize FlhB localization and dynamics in live cells

    • High-speed AFM to directly observe conformational changes

    • Correlative light and electron microscopy to connect function with structure

  • Protein Engineering:

    • CRISPR-Cas9 genome editing for precise manipulation of flhB in diverse bacterial species

    • Unnatural amino acid incorporation to introduce probes at specific sites

    • Split protein complementation systems to monitor protein-protein interactions

  • Systems Biology Approaches:

    • Global analyses of genetic interactions to place FlhB in broader cellular networks

    • Proteomics approaches to identify complete interactomes

    • Computational modeling of the entire flagellar assembly process

  • In Situ Techniques:

    • In-cell NMR to observe conformational changes in the native environment

    • Proximity labeling (BioID, APEX) to map the spatial environment of FlhB

    • Native mass spectrometry to analyze intact complexes

These technologies, especially when applied in combination, promise to provide unprecedented insights into the structure, dynamics, and function of FlhB in flagellar assembly.

What are the most significant unresolved questions about FlhB function that require further investigation?

Despite significant progress in understanding FlhB, several key questions remain:

  • Structural Transitions:

    • What is the precise atomic structure of FlhB before and after the specificity switch?

    • How does FliK interaction trigger conformational changes in FlhB?

    • What is the structural basis for differential substrate recognition?

  • Regulatory Mechanisms:

    • How is FlhB autocleavage regulated during flagellar assembly?

    • What determines the timing of the substrate specificity switch?

    • How do other flagellar proteins modulate FlhB function?

  • Species-Specific Functions:

    • How do the regulatory functions of FlhB vary across bacterial species?

    • Why does FlhB regulate gene expression in some species but not others?

    • How have these functions evolved across bacterial lineages?

  • Integration with Export Apparatus:

    • How does FlhB coordinate with other export apparatus components like FlhA, FliI, and FliH?

    • What is the complete architecture of the assembled export apparatus?

    • How is energy coupling achieved during protein export?

  • Broader Cellular Contexts:

    • How is FlhB expression and function coordinated with other flagellar genes?

    • What environmental signals influence FlhB function?

    • How does FlhB contribute to pathogenesis beyond simple motility?

Addressing these questions will require integrative approaches combining structural biology, genetics, biochemistry, and cell biology.

What collaborative research approaches might accelerate progress in understanding flagellar assembly mechanisms?

Progress in FlhB and flagellar assembly research could be accelerated through:

  • Interdisciplinary Collaborations:

    • Structural biologists and biochemists to determine atomic structures and mechanisms

    • Cell biologists and microbiologists to analyze in vivo function

    • Computational biologists to model complex assembly dynamics

    • Evolutionary biologists to trace the development of these systems

  • Technology Integration:

    • Combining structural techniques (crystallography, cryo-EM) with functional assays

    • Merging single-molecule approaches with systems-level analyses

    • Integrating in vitro reconstitution with in vivo studies

  • Comparative Studies:

    • Systematic analysis of FlhB across diverse bacterial species

    • Comparative studies between flagellar export and virulence-associated type III secretion systems

    • Examination of naturally occurring FlhB variants

  • Resource Development:

    • Creation of comprehensive mutation libraries

    • Development of standardized assays for FlhB function

    • Establishment of open-access databases for flagellar assembly components

  • Industry-Academia Partnerships:

    • Collaboration with pharmaceutical companies for antimicrobial development

    • Partnerships with biotechnology firms for protein secretion applications

    • Engagement with synthetic biology companies for engineered systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.