Recombinant Salmonella typhimurium Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella typhimurium Flagellar Biosynthetic Protein FliP

Recombinant Salmonella typhimurium flagellar biosynthetic protein FliP is a crucial component in the flagellar assembly of bacteria. It plays a significant role in the export of flagellar proteins through a type III secretion system (T3SS), which is essential for bacterial motility. This protein is part of the fliLMNOPQR operon, which encodes several proteins involved in flagellar biosynthesis and export .

Structure and Function of FliP

FliP is a hydrophobic protein that integrates into the bacterial membrane. It exists in two forms: a 25-kDa precursor and a 23-kDa mature form, which results from the cleavage of a signal peptide. This cleavage is important for efficient insertion into the membrane, although it is not strictly necessary for function . FliP, along with FliR, forms the FliP5-FliR1 complex, which is crucial for creating a polypeptide channel for exporting flagellar proteins across the cytoplasmic membrane .

Role in Flagellar Assembly

In flagellar assembly, FliP is essential for the formation of the export apparatus. It works in conjunction with other proteins like FliQ and FliR to facilitate the transport of flagellar components. The FliP5-FliQ4-FliR1 complex has a helical arrangement that allows the direct assembly of the rod component FliE at its distal end, connecting it to the MS ring .

Research Findings

Recent studies have highlighted the importance of FliP in maintaining the structural integrity of the flagellar export apparatus. The M-loop of FliP and the R-plug of FliR prevent leakage during protein translocation, ensuring efficient export . Additionally, the FliH2-FliI1 complex enhances the transport of flagellar proteins by acting as a dynamic carrier, facilitating their docking to the export apparatus .

Data and Tables

Table 1: Properties of FliP and Related Proteins

ProteinMolecular Mass (Da)Function
FliP26,755 (precursor), 23,000 (mature)Forms part of the flagellar export apparatus
FliQ9,592Binds to the FliP5-FliR1 complex, facilitating protein export
FliR28,933Part of the FliP5-FliR1 complex, involved in protein export

Table 2: Key Interactions and Complexes Involving FliP

Complex/InteractionDescription
FliP5-FliR1Forms the polypeptide channel for flagellar protein export
FliP5-FliQ4-FliR1Facilitates the assembly of the rod component FliE
FliH2-FliI1Enhances transport of flagellar proteins by acting as a dynamic carrier

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
fliP; flaR; STM1979; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-245
Protein Length
Full Length of Mature Protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
fliP
Target Protein Sequence
QLPGLISQPLAGGGQSWSLSVQTLVFITSLTFLPAILLMMTSFTRIIIVFGLLRNALGTP SAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEQKISMQEALDKGAQPLRAFMLRQ TREADLALFARLANSGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIA SVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLMGSLAQSFYS
Uniprot No.

Target Background

Function
FliP plays a role in the flagellum-specific transport system.
Gene References Into Functions
  1. FliP forms a homohexamer with the assistance of the FliO complex. The formation of the FliP6 ring is essential for flagellar type III protein export PMID: 28771466
Database Links

KEGG: stm:STM1979

STRING: 99287.STM1979

Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the basic structure and function of the FliP protein in Salmonella typhimurium?

FliP is a membrane protein encoded within the fliLMNOPQR operon, with a predicted molecular mass of 26,755 Da. It exists in two forms: a 25-kDa form and a processed 23-kDa form. The protein is highly hydrophobic and segregates with the membrane fraction when isolated experimentally. FliP is not a structural component of the flagellum itself but is essential for flagellation, likely playing a critical role in the type III export pathway that facilitates the export of flagellar proteins .

The protein undergoes cleavage of a signal peptide—an unusual process for prokaryotic cytoplasmic membrane proteins. This processing appears to be important for efficient insertion of FliP into the bacterial membrane, though it is not absolutely required for functionality .

How does FliP interact with other proteins in the flagellar export apparatus?

FliP functions in concert with FliO, FliQ, and FliR, which are encoded by adjacent genes in the same operon. These proteins collectively form key components of the flagellar protein export machinery. Based on their membrane localization and the phenotypes of mutants, these proteins likely assemble into a membrane-embedded complex that facilitates the export of external flagellar components such as rod proteins, hook proteins, and flagellin .

Research suggests that FliP associates with other membrane components to form a protein-conducting channel that enables the selective passage of flagellar proteins from the cytoplasm across the cell membrane. Their high hydrophobic content supports this role in creating a transmembrane conduit .

What experimental techniques are most effective for purifying recombinant FliP protein?

Purification of recombinant FliP presents challenges due to its hydrophobic nature and membrane association. Effective protocols typically include:

  • Expression systems: T7 polymerase-based expression systems have been successfully employed, with induction using IPTG (1 mM) followed by rifampin treatment to inactivate host RNA polymerase .

  • Membrane protein extraction: Due to its strong membrane association, effective solubilization requires detergents. Sodium dodecyl sulfate (SDS) at 1-2% concentration has been used, though gentler detergents may be preferred for maintaining native structure .

  • Affinity purification: Adding histidine tags facilitates purification via nickel affinity chromatography, though positioning of the tag should be carefully considered to avoid interfering with signal peptide processing.

  • Size exclusion chromatography: This can help separate the two forms of FliP (25-kDa and 23-kDa) for further analysis.

When designing purification strategies, researchers should consider that FliP undergoes signal peptide cleavage, which affects its molecular weight and potentially its solubility properties .

What are the best vector systems for recombinant expression of FliP in different host organisms?

For recombinant expression of FliP, several vector systems have proven effective depending on the research objectives:

Vector TypeHost OrganismAdvantagesConsiderations
pBR322 derivativesE. coliWell-established complementation of fliP mutants, moderate copy numberMay require optimization of promoter strength
pACYC184-basedE. coli/SalmonellaCompatible with other plasmids, suitable for co-expression studiesLower copy number may reduce protein yield
T7 expression vectorsE. coli BL21(DE3)High-level inducible expression, ideal for protein productionMay form inclusion bodies requiring refolding
Single-plasmid constructsAttenuated S. typhimurium strainsSuitable for genetic circuit studies in native contextRequires careful selection of attenuated strains

When designing expression constructs, it is critical to consider the natural context of fliP, which includes overlapping genes in the fliLMNOPQR operon. The fliP gene has a TGATG overlap with fliO, which may affect expression levels when expressed independently .

How can I design effective mutations to study FliP function in flagellar assembly?

Designing effective mutations for studying FliP function requires targeting specific domains while considering the protein's membrane topology:

  • Signal peptide modifications: Site-directed mutations at the cleavage site can impair processing, allowing investigation of the importance of signal peptide cleavage. Previous research has shown that mutations at this site reduce complementation in swarm plate assays but do not eliminate function entirely .

  • Transmembrane domain alterations: Creating chimeric proteins by replacing transmembrane domains with those from other membrane proteins (e.g., MotA) can provide insights into domain-specific functions. Previous work demonstrated that fusion of MotA's first transmembrane span to the mature form of FliP resulted in very weak complementation .

  • Conserved residue substitutions: Comparing FliP sequences across bacterial species can identify highly conserved residues that may be essential for function. Alanine scanning mutagenesis of these residues can identify critical functional sites.

  • Expression-level modifications: Increasing expression levels of mutant FliP proteins has been shown to improve function in some cases, suggesting that certain mutations may affect efficiency rather than completely abolishing function .

When analyzing mutant phenotypes, swarm plate assays provide a reliable readout of flagellar function, while deeper analysis can include electron microscopy to examine flagellar structures and protein export assays to measure secretion efficiency .

How should I design experiments to study the role of FliP in the type III secretion system?

Designing rigorous experiments to investigate FliP's role in type III secretion requires a multifaceted approach:

  • Genetic complementation studies: Utilize fliP mutant strains complemented with plasmids expressing wild-type or modified FliP. Quantify complementation by measuring:

    • Swarming motility on semi-solid agar (0.25-0.3%)

    • Flagellar protein export efficiency by analyzing supernatant fractions

    • Direct flagella enumeration via electron microscopy

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation with other flagellar export components (FliO, FliQ, FliR)

    • Bacterial two-hybrid assays to map interaction domains

    • Cross-linking studies to capture transient interactions during protein export

  • Real-time export dynamics:

    • Fluorescently tagged flagellar substrates to visualize export kinetics

    • Pulse-chase experiments to measure export rates in different FliP variants

  • Structural approaches:

    • Cryo-electron microscopy of membrane fractions containing the export apparatus

    • Site-specific cross-linking to map the topology of FliP within the membrane

Experiments should include appropriate controls, including comparisons to related type III secretion systems and careful consideration of experimental variability through proper replication strategies .

What are the best methodologies for analyzing FliP processing and membrane insertion?

Analysis of FliP processing and membrane insertion requires specialized techniques to track the two forms of the protein (25-kDa unprocessed and 23-kDa processed):

  • Pulse-chase analysis:

    • Label newly synthesized proteins with [35S]methionine (15 μCi for 5 minutes)

    • Chase with excess unlabeled methionine

    • Collect samples at different time points to track processing kinetics

    • Analyze by SDS-PAGE and autoradiography

  • N-terminal sequencing:

    • Purify the 23-kDa processed form of FliP

    • Perform Edman degradation to determine the exact cleavage site

    • Compare with predicted signal peptidase recognition sequences

  • Membrane fractionation:

    • Separate inner and outer membranes using sucrose gradient centrifugation

    • Analyze FliP distribution by western blotting with anti-FliP antibodies

    • Assess membrane integration using alkaline carbonate extraction

  • Site-directed mutagenesis of the signal sequence:

    • Introduce systematic mutations in the predicted signal sequence

    • Measure effects on processing efficiency and membrane localization

    • Correlate with functional complementation in swarm assays

When designing these experiments, it's crucial to consider that FliP processing is rare for prokaryotic cytoplasmic membrane proteins and may involve specific cellular machinery .

How can I differentiate between technical variations and true biological effects when studying FliP in motility assays?

Distinguishing technical variations from biological effects requires robust experimental design and statistical analysis:

  • Proper replication strategy:

    • Use true biological replicates (separate experimental units for each treatment combination)

    • Implement technical repeats (multiple measurements of the same experimental unit)

    • Biological replicates capture variation between independently grown cultures

    • Technical repeats quantify measurement variability

  • Controlling for confounding variables:

    • Standardize media composition, growth conditions, and cell density

    • Use randomized block designs to account for day-to-day variations

    • Include wild-type and known mutant controls in each experimental batch

  • Quantitative motility assays:

    • Measure swim zone diameters at standardized time points

    • Calculate relative motility as a percentage of wild-type performance

    • Include time-course measurements to capture kinetic differences

  • Statistical analysis:

    • Use ANOVA with appropriate post-hoc tests for multiple comparisons

    • Apply mixed-effects models to account for block/batch effects

    • Report variance components to identify sources of experimental variability

Source of VariationExperimental ApproachStatistical Method
Within-strain variabilityMultiple colonies from same strainNested ANOVA
Between-day variabilityBlock design with replicates across daysMixed-effects model
Measurement precisionTechnical repeats of same sampleCoefficient of variation
Medium/environment effectsFactorial design varying conditionsTwo-way ANOVA

When interpreting results, consider that small changes in FliP function may have significant biological consequences due to the complex, multi-component nature of the flagellar system .

How does FliP in Salmonella typhimurium compare to homologs in other bacterial species?

FliP shows significant conservation across bacterial species with flagellar systems, reflecting its essential role in flagellar assembly:

  • Sequence conservation:

    • Higher amino acid sequence identity (compared to nucleotide sequence) between S. typhimurium and E. coli FliP homologs indicates functional conservation

    • Hydrophobic regions show stronger conservation, suggesting preserved membrane topology

    • Signal peptide regions display greater variability while maintaining cleavage functionality

  • Functional conservation:

    • Cross-species complementation studies show that FliP proteins from related species can partially restore function in S. typhimurium fliP mutants

    • The degree of complementation correlates with evolutionary distance

  • Structural homology:

    • Predicted membrane topology is preserved across species

    • Key functional domains maintain spatial relationships despite sequence divergence

  • Evolutionary relationships:

    • FliP belongs to a family of proteins found in both flagellar systems and pathogenic type III secretion systems

    • Comparing FliP to homologs in virulence-associated secretion systems provides insight into functional adaptation

This comparative analysis can guide the identification of universally conserved residues for targeted mutagenesis and help distinguish between structural requirements and species-specific adaptations .

What is the relationship between FliP and virulence-associated type III secretion systems?

FliP and its homologs in virulence-associated type III secretion systems (T3SS) share evolutionary origins and functional similarities:

  • Structural and functional parallels:

    • Flagellar export apparatus and virulence-associated T3SS share core components

    • FliP homologs in pathogenic T3SS systems (often designated SpaP, Spa24, or YscR) serve analogous roles in protein export

    • Both systems form membrane-embedded export channels for substrate translocation

  • Experimental approaches for comparative studies:

    • Creation of chimeric proteins combining domains from flagellar FliP and T3SS homologs

    • Complementation analysis to test functional interchangeability

    • Structural comparison through computational modeling and experimental validation

  • Evolutionary implications:

    • Phylogenetic analysis suggests flagellar systems predate specialized virulence T3SS

    • Gene duplication and specialization events likely led to distinct but related export systems

    • Horizontal gene transfer has contributed to the distribution of these systems among bacterial pathogens

  • Therapeutic relevance:

    • The conserved nature of these export components makes them potential targets for broad-spectrum antimicrobial development

    • Understanding the unique features of FliP compared to virulence T3SS homologs can guide selective targeting strategies

This relationship provides a framework for understanding how bacterial pathogens have adapted core cellular machinery for different functions, from motility to host-pathogen interactions .

How can genetic circuit approaches be applied to study FliP function and regulation?

Genetic circuit approaches offer powerful tools for studying FliP function and regulation in Salmonella typhimurium:

  • Synthetic regulation of fliP expression:

    • Construction of inducible promoter systems to control FliP levels

    • Implementation of feedback loops to study regulatory dynamics

    • Observation of flagellar assembly thresholds and stoichiometric requirements

  • Reporter systems for monitoring expression:

    • Transcriptional and translational fusions to fluorescent proteins

    • Single-cell analysis of expression dynamics using microfluidic platforms

    • Correlation of expression levels with functional outcomes in motility assays

  • Oscillatory circuits for dynamic studies:

    • Implementation of genetic oscillators in S. typhimurium similar to those developed for E. coli

    • Observation of how periodic expression affects flagellar assembly

    • Analysis of temperature-dependent effects on circuit function and flagellar assembly

  • Multi-component circuit design:

    • Simultaneous regulation of multiple flagellar genes to study coordinated expression

    • Investigation of stoichiometric relationships between export apparatus components

    • Creation of synthetic operons with modified gene arrangements

When designing these genetic circuits, researchers should consider that S. typhimurium may respond differently than E. coli to the same genetic constructs, as demonstrated by the shifted period-inducer relationship observed in oscillator systems. These differences may provide insights into species-specific aspects of gene expression and protein function .

What are the best approaches for integrating computational modeling with experimental data on FliP function?

Integrating computational modeling with experimental data can significantly enhance our understanding of FliP function:

  • Structural modeling approaches:

    • Membrane protein topology prediction using hydrophobicity analysis

    • Homology modeling based on related proteins with known structures

    • Molecular dynamics simulations to study membrane insertion and protein-protein interactions

    • Integration of experimental constraints from cross-linking or mutagenesis studies

  • Systems-level modeling:

    • Kinetic models of flagellar protein export incorporating FliP function

    • Stochastic simulations of flagellar assembly accounting for protein availability

    • Parameter estimation using experimental data from complementation studies

    • Sensitivity analysis to identify critical parameters affecting system behavior

  • Data integration frameworks:

    • Bayesian approaches for combining diverse experimental datasets

    • Machine learning methods to identify patterns in mutant phenotypes

    • Network models incorporating genetic and protein interaction data

  • Model validation and refinement:

    • Design of experiments specifically to test model predictions

    • Iterative refinement of models based on new experimental data

    • Development of quantitative metrics for assessing model performance

This integration allows researchers to generate testable hypotheses about FliP function, prioritize experiments, and interpret complex datasets in the context of flagellar assembly and bacterial motility .

What are the most promising future research directions for understanding FliP's role in bacterial motility and pathogenesis?

The study of FliP offers several promising research avenues:

  • High-resolution structural characterization:

    • Cryo-electron microscopy of the complete flagellar export apparatus

    • Single-particle analysis to resolve the membrane-embedded complex

    • Structural dynamics during the export process

  • Mechanistic studies of protein export:

    • Real-time visualization of substrate transit through the export apparatus

    • Energetics of the export process and the role of associated ATPases

    • Substrate recognition and selectivity mechanisms

  • Systems biology integration:

    • Global effects of FliP mutations on bacterial transcriptome and proteome

    • Network analysis of flagellar gene expression under different conditions

    • Quantitative models of resource allocation between motility and other cellular functions

  • Antimicrobial development targeting flagellar export:

    • High-throughput screening for inhibitors of FliP function

    • Structure-based design of molecules that disrupt the export apparatus

    • Evaluation of motility inhibition as an anti-virulence strategy

  • Evolutionary adaptation of export systems:

    • Comparative genomics across diverse bacterial species

    • Experimental evolution to study adaptation under selective pressures

    • Investigation of horizontal gene transfer in diversification of export systems

These directions will benefit from integrating cutting-edge technologies in structural biology, single-cell analysis, and computational modeling with classical genetic and biochemical approaches .

How can I design comprehensive experimental workflows to address complex questions about FliP function?

Designing comprehensive experimental workflows for studying FliP requires careful planning and integration of multiple techniques:

  • Sequential experimental approach:

    • Begin with bioinformatic analysis to guide experimental design

    • Proceed with genetic manipulations (knockouts, site-directed mutagenesis)

    • Follow with biochemical characterization of protein variants

    • Conclude with functional assays and structural studies

  • Multi-level analysis framework:

    • Molecular level: Protein structure, processing, and interactions

    • Cellular level: Flagellar assembly, protein localization, and export dynamics

    • Population level: Motility behavior and adaptation to environmental conditions

  • Integrated methodology workflow:

Experimental StageTechniquesExpected Outcomes
Initial characterizationSequence analysis, topology predictionIdentification of key domains and motifs
Genetic manipulationCRISPR-Cas9 editing, site-directed mutagenesisCreation of targeted FliP variants
Protein analysisMembrane fractionation, western blotting, mass spectrometryCharacterization of processing and localization
Functional assessmentMotility assays, electron microscopy, protein export analysisCorrelation of molecular changes with function
Advanced structural studiesCryo-EM, cross-linking mass spectrometryStructural context of FliP within export apparatus
  • Validation and integration strategy:

    • Use multiple complementary techniques to address the same question

    • Implement appropriate statistical design with biological replicates

    • Develop quantitative metrics for comparing different experimental conditions

    • Create integrative models that explain observations across scales

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.