Recombinant Salmonella typhimurium Flagellar biosynthetic protein fliR (fliR)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The fliR protein is encoded by the fliR gene, located within the fliLMNOPQR operon of Salmonella typhimurium. It is a membrane-localized protein involved in the type III secretion system (T3SS) responsible for exporting flagellar components (e.g., hook, filament proteins) across the cytoplasmic membrane . Together with FlhB, fliR forms part of the export gate within the MS-ring structure, a key component of the basal body .

A. Membrane Topology and Protein Interactions

  • Membrane Integration: fliR contains hydrophobic regions that anchor it to the cytoplasmic membrane .

  • Association with FlhB: Genetic and biochemical studies suggest fliR and FlhB form a 1:1 complex in the basal body . A Salmonella-engineered fliR-FlhB fusion protein successfully complemented null mutants, confirming their functional and physical association .

B. Role in Flagellar Export

fliR facilitates the export of flagellar proteins through the T3SS. Deletion of fliR in Vibrio alginolyticus led to:

  • Reduced Motility: Swarming diameter decreased from 35 mm (wild-type) to 3 mm (ΔfliR) .

  • Downregulated Flagellar Genes: flaA, flaB, flhB, and fliM expression were significantly reduced .

Recombinant Production and Purification

Recombinant fliR is produced in E. coli using expression vectors. Key steps include:

  1. Cloning: The fliR gene is inserted into a plasmid (e.g., pET series) with a His-tag for affinity purification .

  2. Expression: Induced by IPTG or other inducers, yielding a ~28.9 kDa product .

  3. Purification: Nickel-affinity chromatography isolates the His-tagged protein .

Challenges in Production

  • Proper Folding: Membrane proteins like fliR require specific conditions for correct folding .

  • Signal Peptide Processing: Unlike cytoplasmic proteins, fliR lacks a signal peptide, simplifying secretion but complicating membrane insertion .

A. Vaccine Development

ΔfliR mutants exhibit attenuated virulence and serve as live vaccines. In V. alginolyticus, ΔfliR provided 67.2% relative protection in grouper models .

A. Phenotypic Comparison of Wild-Type vs. ΔfliR

ParameterWild-Type (V. alginolyticus)ΔfliR MutationSource
Growth RateNormalUnchanged
Protease ActivityHighUnchanged
Motility35 mm (swarm diameter)3 mm
LD₅₀2.37 × 10⁵ CFU/mL3.48 × 10⁷ CFU/mL

B. Transcriptomic Impact of fliR Deletion

ΔfliR in V. alginolyticus downregulates genes involved in:

  • Flagellar Assembly: flaA, flaB, flhB, fliM .

  • Metabolic Pathways: Carbohydrate, amino acid metabolism .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fliR; flaP; STM1981; Flagellar biosynthetic protein FliR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
fliR
Target Protein Sequence
MIQVTSEQWLYWLHLYFWPLLRVLALISTAPILSERAIPKRVKLGLGIMITLVIAPSLPA NDTPLFSIAALWLAMQQILIGIALGFTMQFAFAAVRTAGEFIGLQMGLSFATFVDPGSHL NMPVLARIMDMLAMLLFLTFNGHLWLISLLVDTFHTLPIGSNPVNSNAFMALARAGGLIF LNGLMLALPVITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGIMLMAALMPLIAPFC EHLFSEIFNLLADIVSEMPINNNP
Uniprot No.

Target Background

Function
Plays a critical role in flagellar biosynthesis.
Database Links

KEGG: stm:STM1981

STRING: 99287.STM1981

Protein Families
FliR/MopE/SpaR family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the flagellar biosynthetic protein FliR in Salmonella typhimurium?

FliR is a membrane protein component of the flagellar export apparatus in Salmonella typhimurium and belongs to the family of proteins essential for flagellar biosynthesis. The protein is encoded by the fliR gene located within the fliLMNOPQR operon in flagellar region IIIb of the S. typhimurium genome . FliR functions as part of the membrane-embedded export gate complex that facilitates the transport of flagellar proteins across the cytoplasmic membrane during flagellar assembly. This complex works in coordination with other flagellar proteins including FliO, FliP, and FliQ, which are contiguously arranged within the same operon . Together, these proteins constitute a specialized protein export pathway critical for the assembly of functional bacterial flagella.

How is the fliR gene organized within the S. typhimurium genome?

The fliR gene is organized within a polycistronic operon, specifically the fliLMNOPQR operon, located in flagellar region IIIb of the S. typhimurium genome . This organization has been confirmed through complementation analysis using plasmids containing different portions of the region. Research indicates that the gene order has been verified through analysis of polarity with Tn10 insertions . The contiguous arrangement of fliO, fliP, fliQ, and fliR genes suggests coordinated expression and functional interdependence of these proteins in the flagellar biosynthesis process. This genomic organization is evolutionarily conserved across various bacterial species, reflecting the fundamental importance of these proteins in bacterial motility mechanisms.

What are the key differences between fliR and other flagellar biosynthetic proteins?

While fliR functions as part of the membrane-embedded export gate complex, other flagellar proteins serve distinct roles in the assembly process. For instance, FliI, unlike FliR, functions as an ATPase that provides energy for the export process . The functional differences between these proteins can be observed in their respective mutant phenotypes. While ΔfliI mutants show reduced but not abolished motility and biofilm formation , suggesting partial redundancy or alternative energy sources, fliR mutants typically exhibit complete loss of flagellar assembly and motility. Additionally, FliO, FliP, and FliQ work in conjunction with FliR but have unique structural characteristics and potentially distinct mechanistic contributions to the export process . These differences highlight the specialized nature of each component within the complex flagellar assembly machinery.

How does FliR contribute to the type III secretion system architecture in S. typhimurium?

FliR forms a crucial component of the type III secretion system (T3SS) specifically dedicated to flagellar assembly. Within this system, FliR integrates into the membrane-embedded export gate complex, forming a selective channel through the cytoplasmic membrane. Research indicates that FliR likely interacts directly with other membrane components, particularly FliP and FliQ, to form a functional secretion channel . Structural studies suggest that FliR contains multiple transmembrane domains that anchor it within the membrane, with specific loops extending into the cytoplasm to facilitate interactions with substrate proteins and other T3SS components.

The evolutionary conservation of FliR across bacterial species that employ flagellar motility suggests it plays a fundamental role in the architecture of the export apparatus. Unlike the FliI ATPase component, which shows some functional redundancy , genetic studies indicate that FliR function cannot be complemented by other proteins, highlighting its essential structural role in the T3SS architecture. This architecture enables the selective export of flagellar components in a precisely controlled temporal sequence during flagellar assembly.

What are the molecular mechanisms underlying the interaction between FliR and other flagellar export proteins?

The molecular interactions between FliR and other flagellar export proteins involve complex protein-protein interfaces that create a functional export apparatus. FliR likely forms a hetero-oligomeric complex primarily with FliP and FliQ, with additional interactions with FliO . These interactions are thought to create a pore-like structure within the bacterial membrane that allows for the selective passage of flagellar substrates.

What evolutionary insights can be gained from comparing fliR sequences across different bacterial species?

Comparative genomic analysis of fliR across bacterial species reveals important evolutionary patterns in flagellar biosynthesis. The high conservation of fliR in flagellated bacteria suggests strong selective pressure to maintain its function, indicating its essential role in flagellar assembly. Sequence analysis reveals conserved domains likely crucial for protein-protein interactions and substrate recognition.

Phylogenetic studies of fliR can provide insights into the evolutionary history of bacterial motility systems and help identify adaptation mechanisms in different environmental niches. Additionally, examining co-evolution patterns between fliR and other flagellar genes can illuminate functional dependencies within the flagellar export apparatus. Variations in fliR sequences across pathogenic and non-pathogenic bacterial strains may also reveal adaptations related to virulence and host interaction strategies. These evolutionary insights could inform targeted approaches for antimicrobial development against pathogenic bacteria by disrupting critical, conserved regions of the FliR protein.

What are the recommended protocols for cloning and expressing recombinant FliR protein?

Cloning and expressing recombinant FliR presents several challenges due to its membrane-associated nature. Based on established methodologies for similar proteins, the following protocol is recommended:

Cloning Strategy:

  • Amplify the fliR gene from S. typhimurium genomic DNA using high-fidelity polymerase chain reaction (PCR) with primers containing appropriate restriction sites .

  • Subclone the amplified fragment into an expression vector such as pET-28a(+) for E. coli expression systems or pTrc99A for complementation studies in Salmonella strains .

  • Verify the recombinant plasmid by restriction digestion and DNA sequencing to confirm accurate insertion and sequence fidelity .

Expression and Purification:

  • Transform the verified plasmid into an appropriate expression host (BL21(DE3) for E. coli or SJW2702 (ΔfliR) for Salmonella complementation) .

  • Induce protein expression with IPTG (typically 0.5-2 mM) as demonstrated in FliI expression protocols .

  • For membrane proteins like FliR, use detergent-based extraction methods with mild detergents such as n-dodecyl β-D-maltoside (DDM) or CHAPS.

  • Purify using affinity chromatography if a fusion tag was incorporated, followed by size exclusion chromatography to obtain pure protein.

  • Verify expression and purification by SDS-PAGE analysis .

Functional Verification:
Complementation assays in ΔfliR mutant strains to assess restoration of motility and flagellar assembly.

How can one assess the functional impact of FliR mutations on flagellar assembly?

Assessing the functional impact of FliR mutations requires multiple complementary approaches:

Mutant Construction and Complementation:

  • Generate targeted mutations in the fliR gene using site-directed mutagenesis.

  • Create deletion mutants (ΔfliR) using homologous recombination techniques .

  • Complement the mutations by introducing wild-type or mutant fliR genes on expression plasmids .

Motility Assays:

  • Swimming motility: Culture cells in low-agar (0.3%) motility medium supplemented with appropriate nutrients and antibiotics. Incubate plates for 5-6 hours and measure migration distance from the inoculation point .

  • Swarming motility: Use specialized swarming agar (0.5-0.7%) and observe colony expansion patterns using phase contrast microscopy .

Flagellar Visualization:

  • Electron microscopy to directly visualize flagellar structures.

  • Fluorescent staining with thiol-reactive dyes (e.g., Alexa Fluor 488) for light microscopy visualization .

  • Measure flagellar number, length, and morphology using imaging software such as ImageJ .

Protein Export Assays:

  • Western blot analysis of flagellar proteins in cellular and supernatant fractions.

  • Pulse-chase experiments with [35S]methionine labeling to track protein export kinetics .

Biofilm Formation Assessment:

  • Test tube assay: Inoculate strains in appropriate media, incubate for 96 hours, and quantify biofilm formation by crystal violet staining .

  • Air-liquid interface method using coverslips with subsequent measurement of optical density (OD595) .

What techniques are most effective for studying protein-protein interactions involving FliR?

Several complementary techniques can effectively characterize protein-protein interactions involving FliR:

In vivo Cross-linking:

  • Treat bacterial cells with membrane-permeable cross-linking agents such as formaldehyde or DSP (dithiobis(succinimidyl propionate)).

  • Isolate protein complexes through affinity purification.

  • Identify interaction partners using mass spectrometry.

Bacterial Two-Hybrid (BTH) System:

  • Create fusion constructs of fliR and potential interaction partners with split adenylate cyclase domains.

  • Co-transform into reporter strains and measure reporter gene activation as an indicator of protein interaction.

  • This system is particularly useful for membrane proteins like FliR.

Co-immunoprecipitation (Co-IP):

  • Generate antibodies against FliR or use epitope-tagged versions.

  • Solubilize membrane fractions with appropriate detergents.

  • Perform immunoprecipitation followed by western blotting or mass spectrometry to identify interaction partners.

Surface Plasmon Resonance (SPR):
For direct biophysical characterization of purified components:

  • Immobilize purified FliR on a sensor chip.

  • Flow potential interaction partners over the chip.

  • Measure binding kinetics and affinity constants.

Cryo-Electron Microscopy:
For structural characterization of the entire flagellar export apparatus:

  • Isolate intact basal body complexes.

  • Perform cryo-EM imaging and 3D reconstruction.

  • Localize FliR within the complex using gold-labeled antibodies or by comparing with ΔfliR structures.

These methodologies can be combined to provide comprehensive insights into FliR's interaction network within the flagellar export apparatus.

How can understanding FliR function contribute to novel antimicrobial strategies?

The essential role of FliR in flagellar assembly presents promising opportunities for antimicrobial development:

Targeted Inhibition Strategies:
The flagellar export apparatus represents an attractive target for antimicrobial development due to its conservation across many bacterial pathogens and absence in eukaryotic cells. FliR, as an essential component of this system, could be specifically targeted to disrupt bacterial motility and virulence . Small molecule inhibitors designed to interfere with FliR function could potentially reduce bacterial colonization, biofilm formation, and dissemination within hosts.

Rationale for FliR as a Target:

  • Evolutionary conservation across bacterial species indicates essential function .

  • Membrane localization makes it potentially accessible to drug molecules.

  • Disruption would affect multiple virulence mechanisms simultaneously (motility, biofilm formation, and potentially type III secretion of virulence factors).

  • The flagellar basal body has a known architecture making it an ideal drug target .

Potential Approaches:

  • Structure-based drug design targeting critical FliR domains involved in protein-protein interactions.

  • High-throughput screening of compound libraries against bacterial strains with reporter systems linked to flagellar assembly.

  • Peptide mimetics designed to compete with natural FliR interactions.

  • CRISPR-Cas delivery systems targeting fliR gene expression.

Research into FliR inhibitors could lead to novel antimicrobials with reduced likelihood of resistance development due to the essential and conserved nature of the target.

What role does FliR play in Salmonella pathogenesis and host-pathogen interactions?

FliR contributes significantly to Salmonella pathogenesis through its essential role in flagellar assembly:

Motility and Invasion:
As a component of the flagellar export apparatus, FliR is essential for the assembly of functional flagella, which in turn enable Salmonella to swim toward and reach appropriate sites for invasion in the intestinal epithelium. This directed motility is critical during the early stages of infection.

Biofilm Formation:
Functional flagella are required for initial attachment and biofilm development . FliR deficiency would significantly impair biofilm formation capabilities, reducing bacterial persistence on both biotic and abiotic surfaces. This has implications for chronic infections and environmental survival.

Immune Recognition and Modulation:
Flagellin, the main component of bacterial flagella, is a potent immunostimulatory molecule recognized by pattern recognition receptors including TLR5 and NLRC4/NAIP5 . Through its role in flagellar assembly, FliR indirectly influences host immune recognition patterns. The flagellin-TLR5 interaction triggers MyD88-mediated NF-κB activation, leading to cytokine and nitric oxide production . Additionally, cytosolic recognition of flagellin by NLRC4 and NAIP5 leads to inflammasome assembly and IL-1β/IL-18 activation .

Virulence Regulation:
The flagellar regulatory cascade interacts with virulence gene expression networks in Salmonella. Disruption of FliR function could therefore have pleiotropic effects on virulence beyond motility impairment.

Understanding these pathogenesis mechanisms can inform both therapeutic approaches and vaccine development strategies against Salmonella infections.

How can FliR be utilized in developing attenuated Salmonella vectors for vaccine delivery?

FliR manipulation offers strategic advantages for developing attenuated Salmonella vaccine vectors:

Attenuation Strategy:
Controlled modification of fliR can create Salmonella strains with attenuated virulence while maintaining immunogenicity. Complete deletion of fliR would eliminate flagellar assembly, significantly reducing virulence while preserving the bacteria's ability to express heterologous antigens. Alternatively, partial function mutations could be engineered to create strains with reduced but not eliminated motility, potentially balancing attenuation with effective tissue colonization.

Advantages of FliR-based Attenuation:

  • Non-reverting attenuation when complete gene deletion is used

  • Retained metabolic fitness of the bacterial vector

  • Elimination of TLR5-mediated inflammatory responses that might otherwise dominate the immune response

  • Potential reduction in reactogenicity of the vaccine

Vector Design Considerations:

  • Complementation systems can be engineered to allow controlled expression of FliR in specific tissues or conditions.

  • The fliR locus could serve as an insertion site for heterologous antigen genes.

  • Mutation rather than deletion might allow for more fine-tuned attenuation.

Immunological Implications:
FliR-deficient Salmonella strains would likely induce different innate immune recognition patterns compared to flagellated strains, potentially altering adaptive immune outcomes. This could be advantageous when tailoring immune responses toward specific protective mechanisms.

Experimental validation of FliR-attenuated Salmonella vectors would need to assess colonization efficiency, persistence, safety profile, and immunogenicity in appropriate animal models before advancing to human trials.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.