Recombinant Salmonella typhimurium Fumarate reductase subunit C (frdC)

What is the Salmonella typhimurium fumarate reductase complex and what role does subunit C play?

Salmonella typhimurium fumarate reductase is a four-subunit membrane protein complex (frdABCD) that catalyzes the reduction of fumarate to succinate during anaerobic respiration. The frdC subunit is a 15 kDa hydrophobic protein that serves as one of the membrane anchor subunits of the complex . The complete fumarate reductase complex (frdDCBA) is essential for the catabolism of fumarate to succinate, which is a key reaction in the bacterial TCA cycle operating under anaerobic conditions . The frdC protein consists of 131 amino acids with a predominantly hydrophobic character, containing multiple transmembrane domains that facilitate proper embedding of the enzyme complex in the bacterial membrane . This structural positioning is crucial for electron transport chain functionality during anaerobic respiration.

What is the amino acid sequence and structural characteristics of frdC?

The amino acid sequence of Salmonella typhimurium frdC is: MTTRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKH GAESWMGFVGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVVTVVILYVALFW . This protein is characterized by its hydrophobic nature, containing multiple transmembrane domains that anchor the fumarate reductase complex to the bacterial membrane. The protein has a molecular weight of approximately 15 kDa and functions as part of the membrane-bound domain of the fumarate reductase complex . Its hydrophobic regions are essential for proper integration into the bacterial membrane, which positions the catalytic subunits correctly for electron transfer and substrate conversion.

How does fumarate reductase activity relate to Salmonella's metabolic adaptation in different environments?

Fumarate reductase plays a crucial role in Salmonella's metabolic flexibility, allowing the bacterium to thrive in oxygen-limited environments. Research has shown that Salmonella modifies its carbon metabolism depending on the ecological niche it inhabits . In agricultural environments such as plant tissues, Salmonella regulates genes involved in fumarate metabolism as part of its adaptation strategy. For example, when comparing wild-type S. Typhimurium to an aceB mutant grown in tomato leaf-based medium, researchers observed differential expression of fumarate reductase genes (frdD and frdA), suggesting that fumarate metabolism is integral to the bacterium's ability to persist in plant-associated environments . This metabolic plasticity contributes to Salmonella's success as a pathogen across diverse hosts and environments.

How is fumarate reductase gene expression regulated in Salmonella?

Gene expression of the fumarate reductase operon (frdDCBA) in Salmonella is tightly regulated by environmental conditions, particularly oxygen availability. Under aerobic conditions, these genes are repressed, but they become upregulated under anaerobic conditions when fumarate serves as a terminal electron acceptor. Research has shown that when Salmonella Typhimurium 14028s is grown in tomato leaf-based medium (TM), the expression of frdD and frdA is significantly upregulated compared to minimal medium (MM) . Interestingly, in an aceB mutant (lacking malate synthase A), this upregulation is diminished, suggesting cross-regulation between different metabolic pathways . This regulatory network ensures that the energetically expensive fumarate reductase complex is only expressed when required for anaerobic respiration, allowing Salmonella to efficiently allocate resources for survival in various environmental niches.

What experimental approaches are most effective for studying frdC function in Salmonella pathogenesis?

To effectively study frdC function in Salmonella pathogenesis, researchers should employ a multi-faceted approach combining genetic, biochemical, and infection models. Gene knockout studies coupled with complementation are fundamental – creating a clean frdC deletion mutant (ΔfrdC) followed by phenotypic characterization and complementation with wild-type or site-directed mutant versions to confirm specificity of observed effects. Techniques like reverse transcription quantitative PCR (RT-qPCR) are valuable for quantifying frdC expression under different conditions, as demonstrated in studies of related genes like frdD and frdA .

For protein-level analysis, recombinant protein expression systems can generate purified frdC for structural and biochemical studies . Protein-protein interaction studies using pulldown assays coupled with mass spectrometry have proven effective for identifying interaction partners, as demonstrated with other Salmonella virulence factors . Metabolomic approaches like GC-MS analysis can detect changes in TCA cycle intermediates (particularly fumarate and succinate) when frdC function is altered .

In vivo relevance can be assessed through competitive infection assays in animal models, where wild-type and mutant strains are co-infected to evaluate relative fitness, similar to approaches used for other virulence factors . For mechanistic studies, techniques like WISH-barcoding with amplicon sequencing allow quantification of strain abundance in complex populations .

How does fumarate accumulation affect Salmonella virulence mechanisms?

Fumarate accumulation has significant implications for Salmonella virulence through both metabolic and regulatory mechanisms. Research with an aceB mutant has demonstrated that fumarate accumulation correlates with enhanced bacterial persistence in plant tissues, suggesting a connection between central carbon metabolism and virulence . Mechanistically, this connection likely involves several pathways.

First, the accumulation of fumarate appears to be linked to the downregulation of fumarate reductase genes (frdD and frdA) in the aceB mutant compared to wild-type S. Typhimurium when grown in tomato leaf-based medium . This suggests a feedback mechanism where fumarate levels influence the expression of its own catabolic machinery.

Second, fumarate may function as a signaling molecule that influences the expression of virulence factors. Similar metabolic-virulence connections have been observed with other central carbon metabolites in Salmonella. For example, the transcriptional regulator YdcR has been shown to control the expression of the virulence factor SrfN in Salmonella , demonstrating that metabolic regulators can directly impact virulence gene expression.

Third, energy production via fumarate metabolism may be critical for powering virulence mechanisms such as type III secretion systems. Protein interaction studies have shown connections between metabolic enzymes and virulence factors, including interactions between YqiC (a virulence-associated protein) and components of the electron transport chain (Complex II, which includes fumarate reductase) and ATP synthase . These interactions suggest that energy metabolism and virulence mechanisms are physically coupled in Salmonella.

Quantitative data from metabolomic studies show that when comparing wild-type S. Typhimurium 14028s and ΔaceB grown in tomato leaf-based medium, fumarate levels are significantly higher in the mutant, with a log2 fold change of approximately +2.5 relative to minimal medium . This substantial increase in fumarate concentration coincides with enhanced persistence, establishing a quantitative relationship between metabolite levels and virulence phenotypes.

What are the challenges and solutions in generating functional recombinant frdC protein for in vitro studies?

Generating functional recombinant frdC protein presents several significant challenges due to its hydrophobic nature and membrane association. The primary challenges include protein solubility issues, maintaining proper folding, and preserving functional interactions with other subunits.

Challenges and Solutions:

• Protein solubility:

  • Challenge: The hydrophobic nature of frdC (131 amino acids with multiple hydrophobic regions) makes it prone to aggregation when expressed in standard E. coli systems .

  • Solution: Expression using specialized vectors containing solubility-enhancing tags such as maltose-binding protein (MBP) or SUMO. Alternative expression hosts like C41(DE3) or C43(DE3) E. coli strains specifically designed for membrane protein expression can improve yields.

• Preserving native structure:

  • Challenge: Detergent solubilization can disrupt the native structure of membrane proteins.

  • Solution: Screen multiple detergents (DDM, LDAO, etc.) to identify optimal conditions. Nanodiscs or amphipols offer alternative membrane-mimetic environments that better preserve protein structure.

• Functional reconstitution:

  • Challenge: frdC functions as part of a multi-subunit complex (frdDCBA), and isolation may disrupt essential interactions.

  • Solution: Co-expression strategies where multiple subunits are expressed simultaneously can preserve complex integrity. Alternatively, in vitro reconstitution using purified components in liposomes can restore functionality.

• Expression verification:

  • Challenge: Confirming successful expression of this small (15 kDa) hydrophobic protein.

  • Solution: Employ specialized detection methods such as Western blotting with specific antibodies or mass spectrometry validation that can detect hydrophobic peptides.

To assess functionality, researchers can measure fumarate reductase activity using spectrophotometric assays tracking the reduction of fumarate to succinate, coupled to the oxidation of an electron donor like NADH, typically with an extinction coefficient (ε) of approximately 6,220 M⁻¹cm⁻¹. Successful expression protocols typically yield 2-5 mg of purified protein per liter of bacterial culture when using optimized conditions.

How does the frdC subunit interact with other components of the fumarate reductase complex?

The frdC subunit serves as a critical membrane anchor for the fumarate reductase complex, interacting with other subunits through specific structural domains. Based on structural homology with related bacterial systems, frdC forms a membrane-embedded domain together with frdD, providing the foundation for the catalytic subunits frdA and frdB .

Specifically, frdC contains transmembrane helices that span the bacterial membrane, with hydrophobic residues facilitating membrane integration. The amino acid sequence (MTTRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKH GAESWMGFVGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVVTVVILYVALFW) reveals multiple hydrophobic regions arranged to form these transmembrane domains .

Interaction studies in related systems suggest that frdC likely interacts with:

• frdD through complementary transmembrane domains, forming the complete membrane anchor

• frdB through interface regions that connect the membrane domain to the catalytic components

• Quinone molecules that shuttle electrons between the respiratory complexes and the fumarate reductase

These interactions are essential for electron transfer from the quinone pool to the catalytic site where fumarate is reduced to succinate. Disruption of these interactions through mutations in the transmembrane domains would be expected to compromise enzyme function and potentially affect Salmonella's anaerobic growth capabilities.

The functional importance of these interactions is supported by observations that proper fumarate reductase activity contributes to Salmonella's metabolic adaptation in various environments, including oxygen-limited conditions found during host infection or in certain agricultural niches .

What is the relationship between frdC expression and other virulence factors in Salmonella?

The relationship between frdC expression and other virulence factors in Salmonella represents a sophisticated integration of metabolism and pathogenesis. While not directly regulated as a classical virulence factor, frdC's role in fumarate reductase activity creates important connections to virulence through several mechanisms:

• Metabolic coordination with virulence regulators:
  Research suggests that metabolic adaptation pathways and virulence regulation are interconnected in Salmonella. For example, studies on the transcriptional regulator YdcR demonstrated its direct role in activating the virulence factor SrfN . Similar regulatory networks likely influence fumarate reductase expression in response to host environments.

• Energy production for virulence mechanisms:
  Protein-protein interaction studies have revealed connections between virulence-associated proteins and components of energy metabolism. YqiC, a protein important for Salmonella pathogenesis, interacts with subunits of Complex II (which includes fumarate reductase) and F₀F₁-ATP synthase . This suggests that energy production through anaerobic respiration using fumarate reductase may directly power virulence mechanisms.

• Environmental adaptation:
  Expression analysis of Salmonella in agricultural environments shows coordinated regulation of metabolic genes (including fumarate reductase components) alongside virulence factors. When comparing wild-type S. Typhimurium to an aceB mutant, differential expression of frdD and frdA was observed alongside changes in persistence ability . This indicates that fumarate metabolism may serve as an environmental sensing mechanism that influences virulence expression.

• Temporal expression patterns:
  Similar to the temporal regulation observed with virulence factor SrfN during infection , fumarate reductase expression is likely regulated in a time-dependent manner as Salmonella transitions between environmental niches and infection stages. This coordinated expression ensures appropriate deployment of both metabolic and virulence functions.

A quantitative comparison of gene expression showed that frdD and frdA were upregulated approximately 2.5-fold in wild-type S. Typhimurium grown in tomato leaf-based medium compared to minimal medium, while this upregulation was significantly diminished in an aceB mutant . This differential expression coincided with altered persistence phenotypes, demonstrating the quantitative relationship between fumarate metabolism and Salmonella's adaptive capabilities.

What are the most reliable methods for measuring fumarate reductase activity in Salmonella?

Accurate measurement of fumarate reductase activity in Salmonella requires careful consideration of assay conditions to maintain enzyme integrity and reflect physiological function. Several complementary approaches provide comprehensive assessment:

• Spectrophotometric enzyme assays:
  The gold standard involves monitoring the oxidation of reduced benzyl viologen (BV) or methyl viologen (MV) coupled to fumarate reduction, measured as a decrease in absorbance at 578 nm. The reaction mixture typically contains:

  • 50 mM phosphate buffer (pH 7.5)

  • 0.1 mM BV or MV (reduced with sodium dithionite)

  • 10 mM fumarate

  • Bacterial membrane fraction or purified enzyme

  Activity can be calculated using the extinction coefficient of BV (ε₅₇₈ = 8,650 M⁻¹cm⁻¹) and reported as μmol fumarate reduced/min/mg protein.

• HPLC-based metabolite quantification:
  This approach directly quantifies the conversion of fumarate to succinate:

  • Incubate membrane preparations with fumarate

  • Extract metabolites with perchloric acid

  • Separate by reversed-phase HPLC

  • Detect succinate formation at 210 nm

  This method avoids potential artifacts from artificial electron donors.

• Oxygen consumption measurements:
  Using an oxygen electrode, indirectly measure fumarate reductase activity through:

  • Monitoring oxygen consumption when electrons are diverted from aerobic respiration to fumarate

  • Adding glycerol-3-phosphate as electron donor

  • Measuring the change in respiration rate upon fumarate addition

• Genetic reporter systems:
  For in vivo activity assessment, construct transcriptional fusions (e.g., frdC-lacZ) to monitor gene expression under different conditions, similar to approaches used for studying other Salmonella metabolic genes .

• RNA expression analysis:
  RT-qPCR quantification of frdC transcript levels provides insight into gene regulation patterns. This approach has been successfully used to quantify expression of related genes (frdD and frdA) in different growth conditions .

When comparing methodologies, spectrophotometric assays offer high sensitivity (detection limit ~1 nmol/min/mg protein) but artificial conditions, while metabolite quantification provides physiological relevance at the cost of lower sensitivity (detection limit ~10 nmol/min/mg protein). The choice of method should be guided by specific research questions and available resources.

How can researchers effectively generate and validate frdC knockout mutants in Salmonella?

Creating and properly validating frdC knockout mutants requires a systematic approach to ensure clean genetic manipulation without polar effects. The following comprehensive methodology outlines the most effective approach:

• Mutant construction:
  The λ Red recombination system provides the most efficient method for targeted gene deletion in Salmonella:

  • Design primers with 40 bp homology arms flanking frdC and 20 bp complementary to an antibiotic resistance cassette

  • Amplify the resistance cassette (e.g., kanamycin)

  • Transform Salmonella carrying pKD46 (λ Red expression plasmid)

  • Select recombinants on antibiotic plates

  • Remove the resistance cassette using FLP recombinase if scarless mutation is desired

• Validation approaches:
  Multiple complementary methods ensure proper mutation:

  a) PCR verification:

  • Junction PCR using primers outside the recombination region

  • Expected product size calculation: wild-type (1060 bp) vs. mutant with kanamycin cassette (~1500 bp)

  • Internal frdC PCR should be negative in the mutant

  b) RT-qPCR confirmation:

  • Quantify transcript levels of frdC and adjacent genes

  • Ensures no polar effects on flanking genes

  • Similar approach has been used to validate expression of related genes frdD and frdA

  c) Whole genome sequencing:

  • Confirms clean deletion and absence of secondary mutations

  • Essential for mutants intended for virulence studies

  d) Phenotypic verification:

  • Growth curves under anaerobic conditions with fumarate as terminal electron acceptor

  • Metabolite profiling to confirm altered fumarate/succinate ratios

  • Comparable to approaches used for aceB mutant characterization

• Complementation studies:
  Essential for confirming phenotype specificity:

  • Clone wild-type frdC into a low-copy plasmid with native promoter

  • Transform into the ΔfrdC mutant

  • Verify restoration of fumarate reductase activity

  • Include controls for plasmid effects

• Growth condition optimization:
  For phenotypic studies, proper growth conditions are critical:

  • Anaerobic chambers with controlled atmosphere (N₂/CO₂/H₂, 85:10:5)

  • Minimal media with 40 mM fumarate as terminal electron acceptor

  • Glycerol (30 mM) as carbon source to ensure fumarate reductase dependency

Using these approaches, researchers can confidently attribute observed phenotypes to frdC deletion rather than unintended genetic alterations or polar effects on adjacent genes. This methodological rigor is essential for meaningful interpretation of results in pathogenesis studies.

What techniques can be used to study the structure-function relationship of the frdC protein?

Understanding the structure-function relationship of frdC requires a multidisciplinary approach combining structural biology, biochemistry, and molecular genetics. The following techniques provide complementary insights:

• Structural determination methods:

  • X-ray crystallography: While challenging for membrane proteins, detergent-solubilized or lipidic cubic phase crystallization can reveal atomic-level details of frdC structure, particularly in complex with other fumarate reductase subunits.

  • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane protein complexes, allowing visualization of frdC within the native complex without crystallization.

  • NMR spectroscopy: For studying dynamics and specific interactions of purified frdC in membrane-mimetic environments.

• Site-directed mutagenesis coupled with functional assays:

  • Systematic alanine scanning of transmembrane regions to identify critical residues

  • Targeted mutations of conserved motifs based on sequence alignments

  • Charge reversal mutations to disrupt putative salt bridges with other subunits

  • Functional impact assessment through fumarate reductase activity assays as described in section 3.1

• Membrane topology mapping:

  • PhoA/LacZ fusion analysis: Creating systematic fusions to determine transmembrane segment orientation

  • Cysteine accessibility methods: SCAM (substituted-cysteine accessibility method) to probe membrane-embedded regions

  • Protease protection assays: To identify protein domains protected by the membrane

• Protein-protein interaction studies:

  • Chemical cross-linking: Using bifunctional reagents to capture interactions between frdC and other complex components

  • Co-immunoprecipitation: To identify interacting partners

  • Bacterial two-hybrid assays: For detecting specific protein-protein interactions in vivo

  • Pull-down assays coupled with mass spectrometry: Similar approaches have successfully identified interaction partners of other Salmonella proteins

• Molecular dynamics simulations:

  • Computational modeling of frdC within a lipid bilayer

  • Simulation of conformational changes during electron transfer

  • Prediction of critical residues for quinone binding

• Electron paramagnetic resonance (EPR) spectroscopy:

  • Spin labeling of specific residues to monitor local environment

  • Distance measurements between labeled sites to validate structural models

  • Detection of conformational changes during catalysis

These approaches have been successfully applied to related membrane proteins. For example, similar structure-function analysis of YqiC in Salmonella revealed that its trimerization via a coiled-coil domain is essential for bacterial pathogenesis . This model of combining mutagenesis with oligomerization assays and in vivo virulence studies provides a template for comprehensive structure-function analysis of frdC.

How can metabolomics be integrated into studies of frdC function in Salmonella?

Metabolomics offers powerful insights into the functional consequences of frdC activity in Salmonella, revealing both direct metabolic effects and broader systemic impacts. An integrated metabolomics approach should include:

• Targeted metabolite analysis:
  Focus on TCA cycle intermediates directly related to fumarate reductase function:

  • GC-MS analysis of fumarate, succinate, malate, and oxaloacetate

  • LC-MS/MS for quantification of less volatile TCA intermediates

  • Isotope labeling (e.g., ¹³C-fumarate) to track metabolic flux through the pathway

  This approach has been successfully applied to track central carbon metabolites in Salmonella grown in different conditions, revealing significant changes in fumarate levels between wild-type and metabolic mutants .

• Metabolic flux analysis:

  • ¹³C metabolic flux analysis (¹³C-MFA) using labeled carbon sources

  • Quantification of flux distribution at metabolic branch points

  • Comparison between wild-type and ΔfrdC strains under anaerobic conditions

  • Mathematical modeling to estimate intracellular fluxes

• Untargeted metabolomics:

  • Broad spectrum metabolite profiling using high-resolution MS

  • Pattern recognition algorithms to identify metabolic signatures

  • Comparison across multiple conditions (aerobic/anaerobic/different carbon sources)

  • Identification of unexpected metabolic consequences of frdC disruption

• Integration with transcriptomics and proteomics:

  • Correlate metabolite changes with gene expression patterns

  • Multi-omics integration to identify regulatory networks

  • Comparison with datasets from other Salmonella metabolic studies

• Experimental design considerations:

  • Sampling methodology: Rapid quenching (e.g., -40°C methanol) to prevent metabolic changes during processing

  • Growth conditions: Precisely controlled anaerobic chambers with defined media composition

  • Time course sampling: Capture dynamic metabolic changes during adaptation

  • Appropriate controls: Include both wild-type and complemented mutant strains

• Data analysis approach:

  • Multivariate statistical methods (PCA, PLS-DA) to identify patterns

  • Pathway enrichment analysis to contextualize findings

  • Visualization tools to map metabolite changes onto known pathways

  • Statistical validation with appropriate multiple testing correction

In a representative example from related research, GC-MS analysis of central carbon metabolites showed that fumarate levels in a Salmonella aceB mutant grown in tomato leaf-based medium were significantly higher (log₂ fold change of approximately +2.5) compared to wild-type, correlating with diminished expression of fumarate reductase genes . This type of integrated analysis reveals how metabolic perturbations in one pathway can influence fumarate metabolism and potentially impact bacterial fitness in specific environments.

How might understanding frdC function contribute to novel antimicrobial strategies?

Understanding frdC function opens several promising avenues for antimicrobial development, particularly against persistent Salmonella infections that rely on anaerobic metabolism. The essential role of fumarate reductase in anaerobic respiration makes it an attractive target with several strategic advantages:

• Target-specific inhibitor development:
  The unique structure of bacterial fumarate reductase, particularly the membrane anchor components like frdC, provides opportunities for selective targeting. Potential approaches include:

  • Small molecule inhibitors that disrupt the interaction between frdC and other complex subunits

  • Compounds that interfere with quinone binding at the frdC-quinone interface

  • Peptide mimetics that destabilize the membrane integration of frdC

  Computational modeling suggests that compounds targeting the transmembrane helices of frdC could achieve selectivity indexes (SI) >100 compared to human mitochondrial proteins.

• Metabolic vulnerability exploitation:
  Research has revealed connections between fumarate metabolism and Salmonella persistence in various environments . Targeting these metabolic adaptations could:

  • Prevent bacterial survival during oxygen limitation in host tissues

  • Disrupt persistence in agricultural environments that serve as reservoirs

  • Create metabolic bottlenecks that synergize with existing antibiotics

• Virulence-metabolism connection:
  Studies have demonstrated that metabolic enzymes can interact with virulence systems in Salmonella . Targeting frdC could therefore:

  • Simultaneously disrupt metabolism and attenuate virulence

  • Prevent energy production needed for virulence factor deployment

  • Interfere with signaling pathways that coordinate metabolism and virulence

• Biofilm disruption potential:
  Anaerobic metabolism supports Salmonella biofilm formation, particularly in deep biofilm layers. frdC inhibitors could:

  • Prevent metabolic adaptation required for biofilm persistence

  • Increase susceptibility of biofilm-embedded bacteria to conventional antibiotics

  • Disrupt established biofilms by targeting their metabolic foundation

• Combination therapy approaches:
  frdC targeting could be particularly effective in combination strategies:

  • Pairing with conventional antibiotics to prevent metabolic escape mechanisms

  • Combining with inhibitors of parallel anaerobic respiratory pathways

  • Sequential treatment to first metabolically weaken bacteria before antimicrobial exposure

The translational pathway would involve screening compound libraries against purified fumarate reductase complex, followed by whole-cell assays under anaerobic conditions, and ultimately infection model testing. Quantitative assessment of target engagement and metabolic impact would be essential for advancing promising candidates toward clinical development.

What role might frdC play in Salmonella adaptation to diverse ecological niches?

Fumarate reductase subunit C (frdC) contributes significantly to Salmonella's remarkable ability to colonize diverse ecological niches through metabolic flexibility and environmental sensing. Research evidence suggests multiple mechanisms through which frdC supports this adaptability:

• Oxygen-limited environment adaptation:
  Fumarate reductase enables Salmonella to thrive in environments with restricted oxygen availability by:

  • Providing alternative respiratory pathways using fumarate as terminal electron acceptor

  • Maintaining redox balance during anaerobic metabolism

  • Supporting energy generation in intestinal lumens, deep tissue abscesses, and within macrophage phagosomes

  This metabolic versatility explains how Salmonella successfully colonizes both aerobic and anaerobic host environments.

• Agricultural niche colonization:
  Recent research demonstrates that Salmonella modifies its carbon metabolism to persist in agricultural settings. Comparative studies of Salmonella grown in various agricultural environments (diluvial sand soil, tomato leaf-based medium, lettuce leaf-based medium) revealed that:

  • Central carbon metabolism is significantly remodeled based on available substrates

  • Expression of fumarate catabolism genes (including frdD and frdA) is differentially regulated in plant-associated environments

  • Mutants with altered fumarate metabolism show modified persistence capabilities in plant tissues

  These findings suggest that fumarate reductase activity contributes to Salmonella's successful colonization of both animal hosts and plant-based reservoirs.

• Metabolic integration with host-derived signals:
  Evidence suggests that fumarate metabolism is integrated into Salmonella's environmental sensing mechanisms:

  • Fumarate levels may serve as signaling cues that trigger appropriate metabolic adaptations

  • The regulatory network connecting fumarate metabolism to other pathways enables coordinated responses to environmental changes

  • This integration allows precise tuning of metabolic activities in response to specific niche conditions

• Potential role in stress responses:
  Beyond energy generation, fumarate reductase may contribute to stress tolerance mechanisms:

  • Maintenance of proton motive force under stress conditions

  • Contribution to acid stress responses through modulation of intracellular pH

  • Potential involvement in defense against oxidative and nitrosative stresses

Quantitative evidence from comparative studies shows that when Salmonella strains were grown in tomato leaf-based medium, wild-type bacteria upregulated frdD and frdA expression approximately 2.5-fold compared to minimal medium, while an aceB mutant showed diminished expression of these genes . This differential regulation was associated with altered fumarate accumulation patterns and persistence capabilities, demonstrating the importance of fumarate metabolism in Salmonella's ecological adaptation strategies.

What emerging technologies might advance our understanding of frdC and fumarate reductase in bacterial pathogenesis?

Several cutting-edge technologies are poised to revolutionize our understanding of frdC and fumarate reductase in bacterial pathogenesis, offering unprecedented insights into structure, function, and biological context:

• Advanced structural biology approaches:

  • Cryo-electron tomography (cryo-ET): Visualizing fumarate reductase complexes in their native membrane environment at near-atomic resolution

  • Microcrystal electron diffraction (MicroED): Determining structures from tiny crystals unsuitable for traditional X-ray crystallography

  • Integrative structural biology: Combining multiple techniques (cryo-EM, NMR, X-ray, computational modeling) to build comprehensive structural models of the complete fumarate reductase complex

• Single-cell technologies:

  • Single-cell RNA-seq: Revealing cell-to-cell variability in frdC expression during infection

  • Single-cell metabolomics: Detecting metabolic heterogeneity in bacterial populations under stress

  • Raman microscopy: Monitoring metabolic activity of individual bacteria in complex environments without labels

• Advanced genetic tools:

  • CRISPR interference (CRISPRi): Precise temporal control of frdC expression to study kinetics of metabolic adaptation

  • Base editing: Creating specific point mutations without double-strand breaks to study structure-function relationships

  • Multiplexed genome engineering: Simultaneously modifying multiple components of fumarate metabolism

• In situ imaging technologies:

  • Correlative light and electron microscopy (CLEM): Combining fluorescence microscopy with electron microscopy to locate and visualize fumarate reductase complexes during infection

  • Expansion microscopy: Physical expansion of samples to achieve super-resolution imaging of protein complexes

  • Metabolic activity reporters: Genetically encoded biosensors for real-time monitoring of fumarate/succinate ratios

• Host-pathogen interface analysis:

  • Organ-on-chip models: Studying Salmonella metabolism in physiologically relevant microenvironments

  • Intravital microscopy: Real-time visualization of bacterial metabolism in living tissues

  • Tissue-clearing techniques: Enabling deep imaging of Salmonella within intact host tissues

• Computational approaches:

  • Machine learning algorithms: Predicting functional consequences of frdC mutations

  • Systems biology modeling: Integrating multi-omics data to create comprehensive models of fumarate metabolism

  • Molecular dynamics simulations: Modeling conformational changes and electron transfer in the fumarate reductase complex

These technologies could be applied to address key questions about frdC, such as its precise membrane topology, interaction with quinones, and contribution to metabolic adaptation during infection. For example, the WISH-barcoding approach used to track multiple Salmonella strains simultaneously in infection models could be adapted to compare numerous frdC variants in parallel, dramatically accelerating structure-function studies.

How does frdC function compare across different bacterial pathogens?

Fumarate reductase subunit C (frdC) exhibits both conserved core functions and specialized adaptations across bacterial pathogens, reflecting evolutionary pressures in different ecological niches:

• Structural conservation and divergence:
  Comparative analysis of frdC across pathogens reveals:

  • Core transmembrane architecture is generally conserved

  • Sequence identity between Salmonella typhimurium frdC and related pathogens ranges from:

    • ~95% with Escherichia coli

    • ~75% with other Enterobacteriaceae (Klebsiella, Citrobacter)

    • ~40-60% with more distant pathogens (Pseudomonas, Vibrio)

  • Greatest variability occurs in loop regions and quinone-binding domains

  • Hydrophobic transmembrane helices show highest conservation

• Functional specialization:
  Differential adaptation of fumarate reductase function is observed in:

  • Enteric pathogens (Salmonella, E. coli): Optimized for intestinal colonization with cyclic exposure to aerobic/anaerobic conditions

  • Soil pathogens (Pseudomonas): Adapted for diverse terminal electron acceptors beyond fumarate

  • Obligate anaerobes (Bacteroides, Clostridium): Complete reliance on anaerobic respiration with specialized fumarate reductase systems

  • Intracellular pathogens (Mycobacterium, Brucella): Modified fumarate reductases adapted to phagosomal environments

• Regulatory differences:
  Expression control mechanisms vary across pathogens:

  • Salmonella shows complex regulation integrating multiple environmental signals

  • E. coli primarily uses FNR (fumarate and nitrate reduction) regulator

  • Some pathogens link fumarate reductase expression to specific virulence regulators

  • Regulatory differences likely reflect niche-specific adaptation

• Contribution to pathogenesis:
  The role of frdC in virulence varies significantly:

  • Critical for Salmonella persistence in specific host environments

  • Essential for Helicobacter pylori colonization of the gastric mucosa

  • Contributes to biofilm formation in multiple pathogens

  • Enables long-term persistence under oxygen limitation

• Comparative genomics insights:
  Analysis across bacterial genomes reveals:

  • Gene synteny (frdDCBA operon structure) highly conserved in Enterobacteriaceae

  • Some pathogens contain multiple fumarate reductase homologs

  • Horizontal gene transfer has shaped fumarate reductase evolution in certain lineages

The significance of these comparisons extends beyond academic interest. Understanding the conserved and variable features of frdC across pathogens helps identify both broad-spectrum antimicrobial targets and pathogen-specific vulnerabilities. The unique adaptations of fumarate reductase systems in different bacteria reflect their evolutionary history and ecological specialization, providing insights into both metabolic flexibility and pathogenic potential.

What are the current limitations and challenges in studying frdC function?

Current research on Salmonella typhimurium frdC faces several significant technical and conceptual challenges that limit our comprehensive understanding of its function:

• Membrane protein challenges:

  • Structural characterization difficulties: High-resolution structures of membrane proteins like frdC are technically challenging, with issues in crystallization, detergent selection, and maintaining native conformation.

  • Expression and purification hurdles: Obtaining sufficient quantities of properly folded frdC for biochemical studies frequently results in protein aggregation or misfolding.

  • Reconstitution complexity: Recreating physiologically relevant membrane environments for functional studies requires optimization of lipid composition and protein-to-lipid ratios.

• Technical limitations:

  • In vivo imaging restrictions: Current techniques lack sufficient resolution to visualize frdC localization and dynamics in living bacteria during infection.

  • Metabolic measurement challenges: Accurately quantifying fumarate reductase activity in situ within different microenvironments of infection remains difficult.

  • Genetic redundancy issues: Potential functional overlap with related enzymes complicates interpretation of knockout phenotypes.

• Physiological context gaps:

  • Microenvironmental heterogeneity: Limited understanding of the precise oxygen concentrations and metabolite availability that frdC encounters in various host niches.

  • Temporal dynamics uncertainty: Insufficient knowledge about when and how quickly fumarate reductase activity changes during infection progression.

  • Host-pathogen interaction effects: Incomplete characterization of how host factors might modulate frdC function or expression.

• Integration challenges:

  • Multi-omics data integration: Difficulties in correlating transcriptomic, proteomic, and metabolomic datasets to build comprehensive models of frdC regulation.

  • Systems-level understanding gaps: Limited capability to predict how alterations in frdC function propagate through bacterial metabolic networks.

  • Cross-disciplinary barriers: Integrating structural biology, metabolism, and pathogenesis research requires diverse expertise.

• Research model limitations:

  • In vitro vs. in vivo discrepancies: Behavior of fumarate reductase in laboratory media often poorly represents its function during actual infection.

  • Animal model constraints: Current models may not accurately recapitulate the metabolic environments encountered in human infection.

  • Bacterial strain variations: Differences between laboratory strains and clinical isolates complicate translation of findings.

Addressing these challenges will require interdisciplinary approaches combining advances in membrane protein biochemistry, metabolic analysis techniques, and infection models. Development of new technologies such as genetic sensors for metabolic activity, improved membrane protein expression systems, and more sophisticated in vivo imaging techniques will be critical for overcoming current limitations in frdC research.

What are the key takeaways about frdC and fumarate reductase for researchers entering this field?

Researchers entering the field of Salmonella typhimurium frdC and fumarate reductase should understand several fundamental concepts that provide a foundation for further investigation:

• Fundamental structural and functional aspects:

  • frdC is a 15 kDa hydrophobic membrane protein (131 amino acids) that serves as one of the membrane anchor subunits of the fumarate reductase complex (frdDCBA) .

  • The complex catalyzes the reduction of fumarate to succinate during anaerobic respiration, with frdC providing membrane integration and participating in quinone interactions.

  • The hydrophobic nature of frdC poses specific challenges for expression, purification, and structural studies that must be addressed with specialized techniques.

• Metabolic context and significance:

  • Fumarate reductase is central to Salmonella's metabolic flexibility, enabling energy generation under anaerobic conditions when oxygen is unavailable as a terminal electron acceptor.

  • This metabolic adaptation is critical for Salmonella's ability to colonize diverse environments, from oxygen-limited intestinal niches to plant tissues .

  • The regulation of fumarate reductase genes (including frdC) is integrated with broader metabolic networks, responding to environmental cues and contributing to bacterial fitness.

• Experimental approaches and considerations:

  • Multiple complementary techniques are required for comprehensive study of frdC, including genetic manipulation, protein biochemistry, metabolomics, and infection models.

  • Particular attention must be paid to creating appropriate anaerobic conditions for functional studies and considering the membrane environment for structural work.

  • Validation of phenotypes through complementation is essential due to potential polar effects in genetic studies involving membrane protein complexes.

• Connection to pathogenesis:

  • Metabolic adaptation through fumarate reductase contributes to Salmonella virulence by enabling bacterial persistence in diverse host environments.

  • The integration of metabolism and virulence is emerging as a key theme, with evidence for physical and regulatory connections between metabolic enzymes and virulence factors .

  • Fumarate metabolism may represent a promising target for antimicrobial development, particularly against persistent infections.

• Current frontiers and opportunities:

  • The precise structural details of frdC and its interactions within the fumarate reductase complex remain to be fully elucidated.

  • The temporal and spatial regulation of fumarate reductase during infection represents an important area for future research.

  • Integrating structural insights with metabolic function and virulence contributions offers opportunities for novel therapeutic approaches.