Recombinant Salmonella typhimurium Glutathione transport system permease protein gsiC (gsiC)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

GsiC is essential for glutathione import, a tripeptide vital for bacterial redox balance and virulence:

  • Glutathione Transport: GsiC works with GsiA (ATPase), GsiB (substrate-binding protein), and GsiD (membrane fusion protein) to translocate extracellular glutathione into the cytoplasm .

  • Virulence Link: Deletion of gsiA (a partner of GsiC) reduces Salmonella enterica virulence, highlighting the system’s role in pathogenicity .

  • Stress Adaptation: Homologous systems in Cronobacter sakazakii show that GsiABCD disruption reduces desiccation tolerance by limiting intracellular glutathione, impairing biofilm formation, and increasing oxidative stress .

Protein Interactions and Mechanism

The GsiABCD transporter operates through coordinated subunit interactions:

  • GsiA-GsiC Binding: Bacterial two-hybrid assays confirm direct interaction between GsiA (ATPase) and GsiC, essential for transporter assembly .

  • Glutathione-Dependent Regulation: GsiB (substrate-binding protein) interacts with GsiC and GsiD only in glutathione-rich environments, suggesting substrate-induced conformational changes .

Table 2: Key Interaction Partners

SubunitRoleInteraction with GsiC
GsiAATP hydrolysisDirect binding via transmembrane domains
GsiBSubstrate bindingInduced by glutathione availability
GsiDMembrane fusionStabilizes transporter complex

Research Applications and Implications

Recombinant GsiC has been utilized in multiple studies:

  • Structural Studies: Purified His-tagged GsiC enables crystallography and membrane protein dynamics research .

  • Antimicrobial Targets: The GsiABCD system’s role in virulence positions it as a potential target for disrupting bacterial glutathione metabolism .

  • Comparative Genomics: Phylogenetic analyses reveal conservation of GsiABCD in Enterobacteriaceae, including E. coli and Shigella .

Technical Considerations for Handling

  • Storage: Stable at -20°C for 6 months (liquid) or -80°C for 12 months (lyophilized) .

  • Activity Loss: Repeated freeze-thaw cycles degrade functionality; working aliquots stored at 4°C retain activity for ≤1 week .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly indicate your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, kindly inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Storage temperatures should be -20°C or -80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
gsiC; STM0850; Glutathione transport system permease protein GsiC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
gsiC
Target Protein Sequence
MLNYVLKRLLGLIPTLLIVAVLVFLFVHLLPGDPARLIAGPEADAQVIALVRQQLGLDQP LHVQFWHYITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAA AVWRNRWPDRLGMTLAVTGISFPAFALGMLLMQIFSVDLGWLPTVGADSWQHYILPSLTL GAAVASVMARFTRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMGLQFG FLLGGSIVVEKVFNWPGLGRLLVDSVDMRDYPVIQAEVLLFSLEFILINLVVDVLYAAIN PAIRYK
Uniprot No.

Target Background

Function
gsiC is part of the ABC transporter complex GsiABCD, which plays a role in glutathione import. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: stm:STM0850

STRING: 99287.STM0850

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems yield optimal recombinant gsiC production?

E. coli expression systems have been successfully used to produce recombinant Salmonella typhimurium gsiC protein. The recombinant protein can be expressed with N-terminal His-tags to facilitate purification, with the full-length sequence (amino acids 1-306) being successfully expressed. The expression construct design should include careful consideration of promoter strength, codon optimization, and appropriate fusion tags .

For membrane proteins like gsiC, expression optimization typically requires:

  • Testing multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3), etc.) that are adapted for membrane protein expression

  • Optimizing induction conditions (temperature, IPTG concentration, induction timing)

  • Evaluating different cell lysis methods to preserve protein structure and function

  • Using specialized membrane protein expression vectors that provide tight regulation of expression

Researchers should monitor expression levels through Western blotting and optimize conditions to balance protein yield with proper folding and membrane integration .

What purification strategies produce high-purity recombinant gsiC?

For His-tagged recombinant gsiC protein, a multi-step purification protocol is recommended:

  • Initial purification using immobilized metal affinity chromatography (IMAC) with Ni-NTA resin

  • Membrane protein solubilization using appropriate detergents (DDM, LDAO, or OG)

  • Size exclusion chromatography to remove aggregates and impurities

  • Optional ion-exchange chromatography for further purification

The final purified protein can be stored as a lyophilized powder. Based on available information, the recommended reconstitution involves dissolving in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage stability .

The purity of the final product should exceed 90% as determined by SDS-PAGE analysis. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How can researchers assess the functionality of purified recombinant gsiC?

Assessing the functionality of purified recombinant gsiC can be approached through several complementary methods:

  • Liposome reconstitution assays: Incorporate purified gsiC into liposomes and measure glutathione transport using fluorescently labeled glutathione or radioactive tracers

  • ATPase activity assays: If gsiC functions as part of an ATP-dependent transport system, coupled ATPase assays can provide indirect evidence of functionality

  • Binding assays: Surface plasmon resonance or isothermal titration calorimetry to measure binding affinity with glutathione or other potential substrates

  • Complementation studies: Express recombinant gsiC in gsiC-deficient Salmonella strains to determine if it restores glutathione transport capability

Each method provides different insights into the functionality of the protein, and a combination of approaches will provide the most comprehensive assessment of the recombinant protein's activity.

What is the role of gsiC in Salmonella virulence and pathogenesis?

While the search results don't directly describe gsiC's role in virulence, its function as a glutathione transport permease suggests potential contributions to Salmonella pathogenesis through several mechanisms:

  • Glutathione acquisition: Glutathione is an important antioxidant that could help Salmonella counteract oxidative stress within host cells

  • Redox homeostasis: Maintaining proper redox balance is crucial for bacterial survival during infection

  • Potential interactions with virulence mechanisms: The gsiC protein might indirectly contribute to Salmonella's ability to trigger inflammatory responses

Research indicates that Salmonella Typhimurium requires intestinal inflammation to sustain its replication in the intestinal tract. The pathogen uses effector proteins from type III secretion systems to trigger inflammatory responses without engaging innate immune receptors. These effectors stimulate MAP kinases and NF-κB signaling in intestinal epithelial cells, resulting in pro-inflammatory cytokine production .

To investigate gsiC's specific role in pathogenesis, researchers should consider generating gsiC knockout mutants and evaluating their ability to colonize host tissues, trigger inflammation, and survive within macrophages compared to wild-type Salmonella.

How might gsiC interact with Salmonella's chemotactic responses in host colonization?

Recent research has demonstrated that Salmonella Typhimurium exhibits specific chemotactic responses that facilitate host colonization. For example, the Tsr chemoreceptor mediates efficient pathogen invasion of colonic tissue. Experiments with colonic explants have shown that Salmonella shows attraction toward human fecal material, which contains compounds like serine and indole that can influence bacterial chemotaxis .

While direct interactions between gsiC and chemotactic machinery aren't described in the search results, there may be functional connections worth investigating:

  • Glutathione transport might alter the energetic status of the cell, indirectly affecting chemotactic responses

  • Environmental glutathione gradients might serve as chemotactic cues in certain host niches

  • Co-regulation of gsiC expression with chemotaxis genes under specific host conditions

To investigate these potential connections, researchers could perform transcriptomic analyses to identify co-expression patterns between gsiC and chemotaxis genes under different environmental conditions. Additionally, competitive index experiments similar to those described for chemotaxis mutants could be applied to gsiC mutants to assess their colonization efficiency .

What methodologies are most effective for studying gsiC function in vivo?

For in vivo studies of gsiC function, several complementary approaches can be employed:

  • Animal infection models: Use of murine, bovine, or swine models with wild-type and gsiC-deficient Salmonella strains to assess colonization, inflammation, and persistence

  • Competitive index assays: Co-infection with wild-type and gsiC mutant strains to determine relative fitness in vivo

  • In vivo expression technology (IVET): To monitor gsiC expression during different stages of infection

  • Intestinal explant models: Similar to the colonic explant infection model described in the search results, which allows for examination of tissue invasion efficiency

The colonic explant model is particularly valuable as it allows for the study of bacterial interactions with host tissue while maintaining the tissue architecture. This approach has been used successfully to study chemotactic responses and could be adapted to investigate gsiC function. The experimental design would involve infecting tissue sections with wild-type and gsiC mutant strains, followed by analysis of both the total bacterial population and the intracellular invaded population .

How can researchers effectively study the regulation of gsiC expression?

Understanding the regulation of gsiC expression requires a multi-faceted approach:

  • Promoter mapping and analysis: Identify the promoter region of gsiC and potential transcription factor binding sites

  • Reporter gene fusions: Create transcriptional and translational fusions with reporter genes (GFP, luciferase) to monitor expression under different conditions

  • Transcriptomic analysis: RNA-seq to determine gsiC expression patterns in different environments and growth phases

  • Chromatin immunoprecipitation (ChIP): Identify proteins that bind to the gsiC promoter region

The regulation of gsiC expression might be linked to specific environmental signals encountered during infection. For example, Salmonella's ability to sense and respond to intestinal environmental cues is critical for its pathogenesis. The search results indicate that Salmonella uses specific mechanisms to trigger inflammation in the intestinal tract, suggesting sophisticated regulatory networks that might also influence gsiC expression .

Researchers should investigate conditions that mimic the host environment, such as low pH, limited nutrients, and oxidative stress, to determine how these factors affect gsiC expression.

What approaches can elucidate the protein-protein interactions of gsiC in the glutathione transport system?

As a permease component of a transport system, gsiC likely interacts with other proteins to form a functional transport complex. Several methods can identify and characterize these interactions:

  • Bacterial two-hybrid assays: Screen for potential interaction partners in a whole-genome manner

  • Co-immunoprecipitation: Pull down gsiC and identify associated proteins by mass spectrometry

  • Cross-linking coupled with mass spectrometry: Identify proximity-based interactions in native membrane environments

  • FRET/BRET assays: Investigate dynamic interactions in living cells using fluorescent or bioluminescent fusion proteins

  • Protein co-purification: Identify proteins that co-purify with affinity-tagged gsiC

For membrane proteins like gsiC, special considerations include the use of appropriate detergents that preserve protein-protein interactions during solubilization and careful selection of tags that don't interfere with complex formation.

The search results don't specifically mention protein-protein interactions for gsiC, but as a component of a transport system, it likely functions in concert with other proteins such as ATPases or substrate-binding proteins to facilitate glutathione transport across the bacterial membrane.

What are the major challenges in crystallizing membrane proteins like gsiC?

Membrane protein crystallization presents several significant challenges:

  • Protein stability: Membrane proteins often become unstable when removed from the lipid bilayer

  • Detergent selection: Finding detergents that maintain protein structure while allowing crystal contacts

  • Conformational heterogeneity: Membrane transporters often adopt multiple conformations

  • Low expression yields: Obtaining sufficient quantities of pure protein

  • Crystal packing: Limited hydrophilic surfaces for forming crystal contacts

To address these challenges, researchers working with gsiC should consider:

  • Screening multiple detergents and lipid-like additives (e.g., bicelles, nanodiscs)

  • Utilizing protein engineering to increase stability (thermostabilizing mutations, fusion proteins)

  • Employing lipidic cubic phase crystallization techniques

  • Testing antibody fragments or nanobodies to stabilize specific conformations

  • Exploring alternative structural determination methods like cryo-electron microscopy

While the search results don't mention crystallization attempts for gsiC specifically, these approaches represent current best practices for membrane protein structural studies.

How can mutagenesis approaches inform gsiC structure-function relationships?

Strategic mutagenesis can provide valuable insights into gsiC's functional mechanisms:

  • Alanine-scanning mutagenesis: Systematically replace residues with alanine to identify functionally important amino acids

  • Cysteine-scanning mutagenesis: Introduce cysteines for accessibility studies or cross-linking experiments

  • Conserved motif analysis: Target evolutionarily conserved regions likely involved in transport function

  • Chimeric protein construction: Exchange domains with related transporters to identify specificity determinants

The search results provide the complete amino acid sequence of gsiC, which can be analyzed for conserved motifs typical of membrane transporters . Comparing this sequence with other bacterial glutathione transporters can identify highly conserved residues that would be prime targets for mutagenesis.

After generating mutants, functional assays (transport activity, substrate binding) and localization studies (to confirm proper membrane integration) should be performed to establish structure-function relationships.

What bioinformatic approaches can enhance gsiC research?

Computational methods can significantly accelerate research on gsiC:

  • Homology modeling: Generate structural models based on related transporters with known structures

  • Molecular dynamics simulations: Study protein dynamics and substrate interactions in a membrane environment

  • Evolutionary analysis: Identify conserved residues and motifs across bacterial species

  • Genomic context analysis: Examine neighboring genes for functional relationships

  • Protein-protein interaction prediction: Identify potential interaction partners based on sequence and structural features

Starting with the amino acid sequence provided in the search results , researchers can perform initial analyses to predict transmembrane domains, identify conserved motifs, and generate preliminary structural models. These computational predictions can then guide experimental design, focusing efforts on the most promising hypotheses.

How might gsiC contribute to Salmonella's antibiotic resistance mechanisms?

The relationship between glutathione transport and antibiotic resistance represents an intriguing research direction:

  • Oxidative stress protection: Glutathione's role as an antioxidant may indirectly contribute to antibiotic tolerance, particularly against drugs that induce oxidative damage

  • Detoxification pathways: Glutathione conjugation can detoxify certain xenobiotics, potentially including antibiotics

  • Metabolic adaptations: Changes in glutathione availability might influence metabolic states associated with persistence or tolerance

Research on Salmonella enterica serotype Typhimurium DT104 has focused on antimicrobial resistance patterns and their emergence . While gsiC is not specifically mentioned in this context, investigating potential connections between glutathione transport and resistance mechanisms could yield valuable insights.

Experimental approaches might include comparing antibiotic susceptibility profiles between wild-type and gsiC-deficient strains, particularly under conditions of oxidative stress or in infection models.

How does the function of gsiC interact with Salmonella's virulence mechanisms?

The integration of glutathione transport with Salmonella's virulence programs presents several research opportunities:

  • Temporal coordination: Investigating whether gsiC expression is coordinated with virulence gene expression during infection

  • Regulatory cross-talk: Identifying shared regulatory elements between gsiC and virulence genes

  • Metabolic contributions: Determining how glutathione transport supports energy needs during host colonization

  • Stress response integration: Examining how glutathione transport contributes to managing host-induced stresses

Salmonella Typhimurium employs sophisticated mechanisms to trigger inflammation in the intestinal tract, using effector proteins of type III secretion systems without engaging innate immune receptors . Investigating whether glutathione transport plays a role in supporting these processes could reveal new aspects of Salmonella pathogenesis.

Experimental approaches might include transcriptomic and proteomic analyses comparing wild-type and gsiC mutants during infection, as well as epistasis studies with mutations in known virulence pathways.

What is the potential for targeting gsiC in antimicrobial development?

As a component of bacterial nutrient acquisition systems, gsiC could represent a novel target for antimicrobial development:

  • Target validation: Determining whether gsiC inhibition sufficiently attenuates Salmonella virulence

  • High-throughput screening: Developing assays to identify small molecule inhibitors of gsiC function

  • Structure-based drug design: Using structural information to design specific inhibitors

  • Combination approaches: Testing gsiC inhibitors in combination with conventional antibiotics

The glutathione transport system may be particularly important during specific stages of infection or in certain host niches. Understanding these contextual requirements would help determine the therapeutic potential of targeting this system.

Given the increasing problem of antibiotic resistance in Salmonella and other pathogens , novel targets like gsiC could contribute to the development of much-needed new antimicrobial strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.