Recombinant Salmonella typhimurium Glutathione transport system permease protein gsiD (gsiD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
gsiD; STM0851; Glutathione transport system permease protein GsiD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
gsiD
Target Protein Sequence
MRLFNWRRQAILHAMPVVKPDQIRTPWREFWRRFRRQHVALVAGGFVLALILVAIFARWL TPYDAENYFDYDSLNNGPSLQHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVFIGAIIGT VLGLLAGYYEGWWDRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAVAIFSIPAFA RLVRGNTLVLKQQTFIESARSIGASDTTILFSHILPGTVSSIVVFFTMRIGTSIISAASL SFLGLGAQPPTPEWGAMLNEARADMVIAPHVALFPAVAIFLTVLAFNLLGDGLRDALDPK IKG
Uniprot No.

Target Background

Function
The gsiD protein is a component of the ABC transporter complex GsiABCD involved in glutathione import. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: stm:STM0851

STRING: 99287.STM0851

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the GsiD protein and what is its function in Salmonella typhimurium?

GsiD (glutathione transport system permease protein D) is a membrane protein component of the glutathione transport system in Salmonella typhimurium. It functions as a permease protein responsible for transporting glutathione across the bacterial cell membrane. The protein plays a critical role in the uptake of extracellular glutathione, thereby contributing to maintaining intracellular glutathione levels that support various cellular functions including protection against oxidative stress and detoxification of xenobiotics .

How does the glutathione transport system operate in Salmonella typhimurium?

The glutathione transport system in Salmonella typhimurium consists of multiple proteins that work together to facilitate the uptake of extracellular glutathione. GsiD functions as a permease component of this system, embedded in the bacterial membrane to create a transport channel. The system actively transports glutathione from the extracellular environment into the bacterial cytoplasm, particularly during the exponential growth phase when metabolic demands are high. Research has demonstrated that bacteria with functional glutathione transport systems show significantly higher intracellular glutathione content compared to those with defective transport mechanisms, such as gsiD deletion mutants .

What are the recommended methods for producing recombinant GsiD protein?

Recombinant GsiD protein can be produced using E. coli expression systems. The recommended approach involves:

  • Cloning the full-length gsiD gene (coding for amino acids 1-303) into an expression vector containing an N-terminal His-tag for purification purposes.

  • Transforming the construct into an E. coli expression strain optimized for membrane protein production.

  • Inducing protein expression under controlled conditions.

  • Lysing the cells and solubilizing membrane proteins with appropriate detergents.

  • Purifying the His-tagged GsiD protein using nickel affinity chromatography.

  • Performing buffer exchange and concentrating the protein.

  • Lyophilizing the purified protein for long-term storage .

For maximum stability and functionality, the recombinant protein should be stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

How can researchers create gsiD deletion mutants for functional studies?

Creating gsiD deletion mutants involves the following methodological approach:

  • Design primers targeting the flanking regions of the gsiD gene in the Salmonella typhimurium genome.

  • Amplify a selectable marker (typically an antibiotic resistance gene) with overhangs homologous to the flanking regions of gsiD.

  • Transform the bacterial cells with this construct, allowing homologous recombination to replace the gsiD gene with the selectable marker.

  • Select potential mutants on appropriate antibiotic-containing media.

  • Confirm the deletion using PCR with primers specific to:

    • The inserted marker gene

    • The junction regions where the marker has integrated

    • The deleted gsiD gene (which should yield no amplification product in successful deletion mutants) .

The deletion can be verified by multiplex PCR approaches similar to those described for other Salmonella genes, such as invA and TSR3 .

What analytical methods are recommended for measuring glutathione transport activity?

To measure glutathione transport activity in relation to GsiD function, researchers can employ the following methods:

  • Intracellular glutathione content measurement:

    • Grow bacterial cultures to exponential phase

    • Add known concentrations of glutathione to the culture medium

    • Harvest cells at specific time points

    • Lyse cells and quantify intracellular glutathione using colorimetric or fluorometric assays

    • Compare wild-type strains with gsiD deletion mutants

  • Radiolabeled glutathione transport assays:

    • Use radiolabeled glutathione (35S-GSH) in the medium

    • Measure radioactivity in harvested cells to quantify uptake rates

    • Calculate transport kinetics parameters (Km, Vmax)

  • Complementation studies:

    • Reintroduce the gsiD gene on a plasmid vector into deletion mutants

    • Compare glutathione uptake between wild-type, deletion mutant, and complemented strains to confirm specific contribution of gsiD to transport activity

How does gsiD function relate to bacterial stress responses and survival?

GsiD plays a critical role in bacterial stress responses by facilitating glutathione uptake, which directly impacts survival under various stress conditions. Research has demonstrated that:

  • Desiccation tolerance: GsiD-mediated glutathione transport significantly enhances bacterial survival under drying stress. Studies with gsiD deletion mutants show decreased desiccation tolerance due to reduced intracellular glutathione content. This suggests GsiD is essential for maintaining sufficient glutathione levels to protect against oxidative damage during desiccation .

  • Oxidative stress protection: Glutathione is a major antioxidant in bacterial cells. By facilitating glutathione uptake, GsiD contributes to the cell's capacity to neutralize reactive oxygen species and maintain redox homeostasis under oxidative stress conditions.

  • Virulence and colonization: Adequate glutathione levels supported by GsiD-mediated transport may enhance bacterial survival during host infection, particularly when bacteria encounter oxidative bursts from host immune cells. This connection suggests potential relevance of GsiD to Salmonella pathogenesis .

The relationship between glutathione transport and stress tolerance highlights GsiD as a potential target for developing novel antimicrobial strategies that could compromise bacterial survival under stressful conditions.

What is the relationship between GsiD function and antimicrobial resistance in Salmonella typhimurium?

While direct evidence linking GsiD specifically to antimicrobial resistance is limited in the available search results, several important connections can be made based on glutathione's known functions:

  • Detoxification of antimicrobials: Glutathione participates in detoxification pathways for various antimicrobial compounds. By facilitating glutathione uptake, GsiD may indirectly contribute to bacterial tolerance against certain antibiotics, particularly those that generate oxidative stress as part of their killing mechanism.

  • Emerging resistance patterns: Salmonella strains are increasingly developing extensive drug resistance. Understanding transport systems like that involving GsiD could provide insights into novel approaches to combat resistance .

  • Potential interaction with efflux systems: Glutathione conjugation systems often work in concert with efflux pumps to remove toxic compounds from bacterial cells. GsiD's role in glutathione homeostasis may interact with these broader detoxification networks.

Researchers studying antimicrobial resistance mechanisms should consider investigating potential correlations between gsiD expression levels and resistance profiles, particularly for antibiotics like chloramphenicol, ampicillin, and trimethoprim, which are commonly used against Salmonella infections .

How can GsiD be targeted for potential therapeutic interventions against Salmonella infections?

GsiD represents a potential therapeutic target due to its importance in glutathione transport and bacterial stress tolerance. Several strategies for targeting GsiD include:

  • Small molecule inhibitors:

    • Design compounds that specifically bind to GsiD and block its transport function

    • Screen for molecules that disrupt protein-protein interactions within the glutathione transport system

    • Develop peptidomimetics based on the substrate-binding regions of GsiD

  • Immunological approaches:

    • Use recombinant GsiD protein as an antigen to develop antibodies that interfere with its function

    • Explore whether anti-GsiD antibodies could enhance agglutination of Salmonella typhimurium, similar to mechanisms observed with secretory IgA

  • Genetic approaches:

    • Target gsiD expression using antisense RNA or CRISPR interference strategies

    • Design bacteriophage-delivered systems to specifically disrupt gsiD function in Salmonella

  • Combination therapies:

    • Combine GsiD inhibitors with conventional antibiotics to enhance bacterial susceptibility

    • Pair GsiD targeting with oxidative stress-inducing agents to maximize bacterial killing

Given that the infectious dose of Salmonella typhimurium is estimated to be between 10³ and 10¹⁰ organisms (with an ID₅₀ of approximately 4.33 × 10³ CFU) , therapeutic strategies that significantly compromise bacterial fitness through GsiD inhibition could potentially reduce the bacterial burden below infectious thresholds.

What are the key considerations for designing experiments to study GsiD function?

When designing experiments to study GsiD function, researchers should consider:

  • Appropriate controls:

    • Wild-type strains with intact gsiD

    • Deletion mutants (ΔgsiD)

    • Complemented strains (ΔgsiD + plasmid-expressed gsiD) to confirm phenotype specificity

    • Strains with mutated but not deleted gsiD to study structure-function relationships

  • Growth conditions:

    • Exponential phase cultures for maximum glutathione transport activity

    • Varying glutathione concentrations in growth media (typically 0-10 mM range)

    • Stress conditions relevant to Salmonella lifecycle (e.g., desiccation, oxidative stress)

  • Measurement parameters:

    • Intracellular glutathione content as primary readout for transport function

    • Cell viability under various stress conditions

    • Membrane integrity and permeability

    • Gene expression of related stress response pathways

  • Technical considerations:

    • Protein expression challenges due to GsiD being a membrane protein

    • Selection of appropriate detergents for solubilization

    • Storage conditions to maintain protein stability (Tris/PBS-based buffer with 6% trehalose, pH 8.0)

    • Prevention of repeated freeze-thaw cycles that compromise protein integrity

  • Statistical analysis:

    • Appropriate replicate numbers (minimum n=3)

    • Statistical tests suitable for the data distribution

    • Correction for multiple comparisons when necessary

How can researchers address data contradictions in GsiD-related studies?

When addressing contradictions in data related to GsiD studies, researchers should implement a systematic approach:

  • Identify potential sources of contradiction:

    • Differences in bacterial strains or genetic backgrounds

    • Variations in experimental conditions (media composition, growth phase, stress parameters)

    • Technical differences in protein preparation or assay methodologies

    • Data interpretation differences across research groups

  • Implement validation strategies:

    • Replicate experiments under standardized conditions

    • Use multiple complementary techniques to measure the same parameter

    • Perform genetic complementation to confirm phenotype specificity

    • Collaborate with other laboratories for independent verification

  • Apply contradiction detection methodologies:

    • Leverage computational approaches similar to those used in clinical contradiction detection

    • Analyze paired experimental results systematically to identify true contradictions versus apparent contradictions due to context differences

    • Consider ontology-driven approaches to classify potential contradictions in the literature

  • Resolution framework:

    • Design definitive experiments that directly address the contradiction

    • Consider variables not previously controlled for

    • Report negative results and contradictions transparently in publications

    • Propose mechanistic explanations that could accommodate seemingly contradictory observations

As demonstrated in clinical contradiction detection research, paired analysis of potentially contradictory findings can reveal that apparent contradictions often stem from differences in experimental design or intervention specifics rather than true scientific contradictions .

What methodological approaches can ensure reproducibility in GsiD functional studies?

To ensure reproducibility in GsiD functional studies, researchers should implement the following methodological approaches:

  • Standardized protocols:

    • Detailed documentation of all experimental procedures

    • Precise specification of reagents, including catalog numbers and lot information

    • Standardized protein reconstitution methods (e.g., reconstituting in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol as a final concentration)

  • Quality control measures:

    • Protein purity verification (>90% as determined by SDS-PAGE)

    • Functional validation of recombinant proteins

    • Genetic verification of bacterial strains through PCR and sequencing

    • Regular testing for contamination

  • Robust experimental design:

    • Appropriate sample sizes based on power calculations

    • Inclusion of all necessary controls

    • Randomization and blinding where applicable

    • Technical and biological replicates

  • Data reporting standards:

    • Complete reporting of all data, including outliers

    • Raw data availability

    • Detailed statistical analysis methods

    • Sharing of computer code and analysis pipelines

  • Validation across systems:

    • Testing findings in multiple Salmonella strains

    • Comparing results across different growth conditions

    • Verifying key findings using complementary methodological approaches

  • Storage and handling guidelines:

    • Store recombinant proteins at -20°C/-80°C upon receipt

    • Aliquot for multiple use to avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • Briefly centrifuge vials prior to opening to bring contents to the bottom

How can GsiD research contribute to understanding Salmonella pathogenesis and infection mechanisms?

GsiD research can significantly advance our understanding of Salmonella pathogenesis through several avenues:

  • Host-pathogen interactions:

    • GsiD-mediated glutathione uptake may enhance Salmonella survival within host cells, particularly in glutathione-rich environments

    • Understanding how GsiD function affects bacterial survival during host immune responses, especially oxidative bursts

    • Investigating whether GsiD activity correlates with Salmonella persistence in specific host tissues

  • Infection dynamics:

    • The infectious dose of Salmonella typhimurium ranges from 10³ to 10¹⁰ organisms, with ID₅₀ estimated at 4.33 × 10³ CFU

    • GsiD function may influence whether bacterial loads reach the threshold needed for successful infection

    • Correlation between glutathione transport efficiency and bacterial load in various infection models

  • Virulence regulation:

    • Potential crosstalk between glutathione homeostasis and virulence gene expression

    • Role of GsiD in Salmonella survival within gut-associated lymphoid tissues, where recombinant antibodies have been shown to limit bacterial invasion

    • Relationship between GsiD function and Salmonella agglutination, which can affect bacterial dispersal and infection progression

  • Therapeutic implications:

    • Development of anti-virulence strategies targeting GsiD

    • Potential for combination approaches using GsiD inhibitors with host immune modulators

    • Vaccination strategies incorporating GsiD as an antigen

What are the emerging research directions for GsiD and the glutathione transport system?

Emerging research directions for GsiD and the glutathione transport system include:

  • Systems biology approaches:

    • Integration of GsiD function into broader metabolic and stress response networks

    • Computational modeling of glutathione transport kinetics and its impact on cellular physiology

    • Multi-omics analysis of how GsiD activity affects global bacterial responses

  • Structural biology:

    • Determination of GsiD three-dimensional structure through crystallography or cryo-EM

    • Structure-based design of specific inhibitors

    • Analysis of conformational changes during transport cycles

  • Host-microbiome interactions:

    • GsiD role in Salmonella competition within the gut microbiome

    • Impact of glutathione transport on bacterial colonization dynamics

    • Influence of dietary glutathione on infection susceptibility

  • Biofilm formation:

    • Connection between glutathione transport and biofilm development

    • Role of GsiD in stress tolerance within biofilm structures

    • Potential of targeting GsiD to disrupt biofilm formation during infection

  • Cross-species comparative studies:

    • Comparison of GsiD function across different Salmonella serovars

    • Evolution of glutathione transport systems across bacterial species

    • Functional differences between GsiD homologs in various pathogens

What techniques are emerging for high-throughput analysis of GsiD interactions and functions?

Several emerging techniques show promise for high-throughput analysis of GsiD interactions and functions:

  • Protein-protein interaction screening:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Split-reporter assays for in vivo interaction detection

    • Proximity labeling approaches (BioID, APEX) to identify proteins in spatial proximity to GsiD

  • Functional genomics:

    • CRISPR interference screens to identify genetic interactions with gsiD

    • Transposon sequencing (Tn-Seq) under conditions requiring glutathione transport

    • RNA-Seq analysis of transcriptional changes in response to GsiD modulation

  • High-content screening:

    • Fluorescence-based transport assays adaptable to 96 or 384-well formats

    • Automated microscopy to monitor glutathione levels and bacterial stress responses

    • Reporter systems linked to glutathione-dependent processes

  • Chemical biology approaches:

    • Small molecule library screening for GsiD inhibitors

    • Activity-based protein profiling to assess GsiD functional state

    • Photocrosslinking strategies to capture transient interactions

  • Microfluidics and single-cell analysis:

    • Droplet-based bacterial encapsulation for single-cell transport studies

    • Microfluidic devices to monitor real-time glutathione uptake

    • Single-cell tracking of bacterial responses to glutathione availability and stress conditions

These emerging technologies will enable researchers to conduct more comprehensive and higher-throughput analyses of GsiD function, potentially accelerating discoveries related to Salmonella pathogenesis and the development of novel antimicrobial strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.