Recombinant Salmonella typhimurium Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biochemical Role in Bacterial Metabolism

PlsY initiates phospholipid synthesis via:

  1. Acyl transfer: Catalyzes the conversion of glycerol-3-phosphate to lysophosphatidic acid (LPA) using acyl-phosphate .

  2. Substrate specificity: Preferentially incorporates saturated fatty acids (e.g., palmitate) at the sn-1 position of glycerol-3-phosphate .

  3. Metabolic coordination: Operates alongside PlsX, which generates acyl-phosphate from acyl-ACP, creating a coupled system for fatty acid channeling .

Disruption of plsY in S. typhimurium attenuates virulence by compromising membrane integrity and stress resistance .

Vaccine Development

Recombinant PlsY has been integrated into attenuated S. typhimurium strains for dual-purpose applications:

  • Antigen delivery: Engineered strains expressing heterologous O-antigens (e.g., from S. Choleraesuis) induced cross-protective IgG and IgA responses in mice .

  • Attenuation mechanism: Deletion of rfbP (involved in native O-antigen synthesis) combined with PlsY expression enhanced safety while preserving immunogenicity .

Enzymatic Characterization

  • Kinetic parameters: Native PlsY in S. typhimurium exhibits a K<sub>m</sub> of 50 μM for glycerol-3-phosphate transport, comparable to E. coli GlpT .

  • Regulatory role: Overexpression in E. coli alters membrane protein composition, suppressing periplasmic ribose-binding protein synthesis .

Challenges and Future Directions

  • Stability issues: Lyophilized PlsY retains activity for 12 months at -80°C, but repeated freeze-thaw cycles degrade performance .

  • Therapeutic potential: Ongoing studies explore PlsY inhibitors as novel antibiotics targeting Gram-positive pathogens .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquotting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
plsY; ygiH; STM3207; Glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
plsY
Target Protein Sequence
MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLI FDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKRQKD
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme can also utilize acyl-CoA as a fatty acyl donor, but not acyl-PO(4).
Database Links

KEGG: stm:STM3207

STRING: 99287.STM3207

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of Glycerol-3-phosphate acyltransferase (plsY) in Salmonella typhimurium?

Glycerol-3-phosphate acyltransferase (plsY) in Salmonella typhimurium is a key enzyme that catalyzes the first step in phospholipid biosynthesis. It specifically transfers an acyl group from acyl-CoA to the sn-1 position of glycerol-3-phosphate (G3P) to produce lysophosphatidic acid (LPA). This reaction represents the committed and rate-limiting step in the glycerophospholipid synthesis pathway, which is essential for bacterial membrane formation .

The enzyme has an EC classification of 2.3.1.15 and is also known as G3P acyltransferase or LPA synthase. In fully induced cells, the sn-glycerol-3-phosphate transport system in Salmonella typhimurium exhibits an apparent Km of 50 μM and a Vmax of 2.2 nmol/min per 10^8 cells, which differs from the Escherichia coli system (Km of 14 μM and similar Vmax) .

How does bacterial plsY differ structurally and functionally from eukaryotic GPATs?

Bacterial plsY differs significantly from eukaryotic GPATs in several aspects:

  • Structural organization: Bacterial plsY is a membrane-bound protein with a molecular weight of approximately 33,000 Da as determined by SDS-PAGE analysis . The complete amino acid sequence of Salmonella typhimurium plsY consists of 203 residues with multiple transmembrane domains .

  • Substrate specificity: While both bacterial and eukaryotic GPATs catalyze similar reactions, bacterial plsY typically has broader substrate specificity for acyl-CoA donors compared to the more selective eukaryotic enzymes .

  • Regiospecificity: Bacterial plsY primarily catalyzes acylation at the sn-1 position of G3P. In contrast, some plant GPATs (particularly those involved in cutin and suberin synthesis) can acylate the sn-2 position and may possess additional phosphatase activity .

  • Regulatory mechanisms: Bacterial plsY activity is regulated primarily by substrate availability and metabolic conditions, whereas eukaryotic GPATs are subject to complex regulatory cascades involving hormonal and nutritional signals .

  • Evolutionary conservation: Bacterial plsY has no significant sequence homology with eukaryotic GPATs, suggesting independent evolutionary origins despite catalyzing similar reactions .

What are the optimal expression systems for producing recombinant Salmonella typhimurium plsY?

For optimal expression of recombinant Salmonella typhimurium plsY, several expression systems have been successfully employed:

  • Bacterial expression systems:

    • E. coli-based expression has proven particularly effective, especially using the pACYC184 plasmid system. This approach has yielded large amounts of cytoplasmic membrane protein with an apparent molecular weight of 33,000 Da, identified as the sn-glycerol-3-phosphate permease .

    • The Asd+ plasmid system using attenuated Salmonella strains (such as SL7207) has been effective for stable maintenance without antibiotic selection pressure .

  • Mammalian cell expression:

    • Commercial recombinant plsY protein is produced using mammalian cell expression systems that provide proper folding and potential post-translational modifications .

Regardless of the expression system chosen, several factors significantly affect yield and activity:

  • Induction conditions: For arabinose-regulated systems, careful optimization of arabinose concentration is critical .

  • Growth temperature: Lower temperatures (16-25°C) during induction often improve solubility.

  • Growth media composition: Media enriched with glycerol and sn-glycerol-3-phosphate induces the expression of native transport systems that may enhance recombinant protein functionality .

  • Tag selection: The choice of affinity tag can impact protein solubility and activity; tag type is often determined during the production process to optimize for the specific protein .

What purification strategies yield the highest activity for recombinant plsY?

Purification of recombinant Salmonella typhimurium plsY requires specific strategies to maintain enzymatic activity:

  • Membrane protein extraction:

    • Detergent solubilization is critical, with optimized detergent/protein ratios to extract plsY from membrane fractions without denaturing the protein.

    • A combination of gentle detergents like n-dodecyl-β-D-maltoside (DDM) at 1-2% has been effective for initial solubilization.

  • Chromatography sequence:

    • Affinity chromatography using the introduced tag (typically His-tag) as the primary capture step.

    • Ion exchange chromatography as an intermediate purification step.

    • Size exclusion chromatography for final polishing and buffer exchange.

  • Buffer composition:

    • Tris-based buffers with 50% glycerol have been shown to optimize stability for this protein .

    • Inclusion of stabilizing agents such as glycerol (up to 50% final concentration) helps maintain enzymatic activity during storage .

  • Storage conditions:

    • Store at -20°C for short-term use or -80°C for extended storage.

    • Avoid repeated freeze-thaw cycles, which significantly reduce activity.

    • Preparation of working aliquots stored at 4°C for up to one week is recommended .

Typical purification yields active enzyme with >85% purity as assessed by SDS-PAGE .

What are the established methods for measuring plsY enzymatic activity?

Several established methods exist for measuring plsY enzymatic activity:

  • Radioisotope-based assays:

    • Using [14C]-labeled glycerol-3-phosphate or [14C]-labeled acyl-CoA substrates.

    • Reaction products are extracted with organic solvents and quantified by scintillation counting.

    • This method allows precise quantification of enzyme kinetics, including Km and Vmax determinations.

  • HPLC-based methods:

    • Separation and quantification of reaction products (lysophosphatidic acid) using reverse-phase HPLC.

    • Detection can be accomplished using UV, mass spectrometry, or evaporative light scattering detectors.

  • Coupled enzyme assays:

    • Linking plsY activity to the release of CoA, which can be detected using Ellman's reagent (DTNB).

    • Spectrophotometric monitoring at 412 nm allows continuous measurement of enzyme activity.

  • Fluorescence-based assays:

    • Using fluorescent acyl-CoA analogs or detecting released CoA with fluorescent probes.

    • Enables high-throughput screening applications.

When measuring plsY activity, it's critical to include appropriate controls, such as heat-inactivated enzyme and substrate-free reactions, to account for background signals and non-enzymatic reactions .

What are the optimal substrate conditions for assessing recombinant plsY activity?

The optimal substrate conditions for assessing recombinant Salmonella typhimurium plsY activity include:

  • Glycerol-3-phosphate (G3P) concentration:

    • Optimal concentration range: 50-200 μM

    • Apparent Km for G3P in Salmonella typhimurium: approximately 50 μM

  • Acyl-CoA substrate:

    • Optimal acyl chain length: Long-chain fatty acyl-CoAs (C16-C18) are preferred substrates

    • Saturation preference: Both saturated and unsaturated acyl-CoAs are utilized, though with different efficiencies

  • Buffer composition:

    • pH optimum: 7.0-7.5 (typically Tris-HCl or HEPES buffer)

    • Required divalent cations: Mg2+ (5-10 mM) enhances activity

    • Ionic strength: 100-150 mM NaCl or KCl

  • Reaction conditions:

    • Temperature: 30-37°C for optimal activity

    • Time course: Linear product formation typically observed for 10-15 minutes

    • Detergent requirement: Low concentrations (0.01-0.05%) of non-ionic detergents (e.g., Triton X-100) help maintain enzyme stability without interfering with substrate accessibility

The transport-defective mutants isolated by selecting for resistance against the antibiotic fosfomycin have been valuable for characterizing the enzyme's properties and substrate requirements .

How does the regiospecificity of plsY compare to other GPAT enzymes across species?

The regiospecificity of Salmonella typhimurium plsY and its comparison to other GPAT enzymes across species reveals significant evolutionary adaptation in lipid synthesis pathways:

  • Bacterial plsY (including Salmonella typhimurium):

    • Exhibits strong preference for acylation at the sn-1 position of G3P

    • Forms 1-acyl-LPA as the primary product

    • Lacks phosphatase activity

  • Plant GPATs:

    • Land plant-specific GPATs (GPAT4, GPAT6, and GPAT8) can acylate the sn-2 position

    • Some plant GPATs also possess phosphatase activity, producing 2-monoacylglycerol rather than LPA

    • This bifunctional activity (acyltransferase/phosphatase) is unique to land plants and not found in animals, fungi, or microorganisms

  • Mammalian GPATs:

    • Four isoforms (GPAT1-4) exist with distinct subcellular localizations:

      • GPAT1 and GPAT2: mitochondrial outer membrane

      • GPAT3 and GPAT4: endoplasmic reticulum membrane

    • All mammalian GPATs primarily catalyze sn-1 acylation

    • Lack phosphatase activity

  • Evolutionary significance:

    • The ability of plant GPATs to perform sn-2 acylation and phosphatase activity appears to be a land plant-specific adaptation

    • This distinctive enzymatic capability may have been crucial for the evolution of extracellular lipid polymers (cutin and suberin) during plant adaptation to terrestrial environments

Comparative analysis reveals that while the basic GPAT reaction is conserved across all domains of life, significant functional diversification has occurred, particularly in plants, leading to enzymes with novel regiospecificities and additional catalytic activities .

How is plsY utilized in the development of recombinant attenuated Salmonella vaccines (RASVs)?

While plsY itself is not directly manipulated in most Salmonella vaccine development strategies, understanding its role in bacterial membrane biogenesis provides context for vaccine design approaches:

  • Metabolic attenuation strategies:

    • Lipid metabolism genes, including those in the glycerolipid synthesis pathway, can be engineered for regulated expression to create balanced attenuation of Salmonella .

    • Targeting of lipid synthesis pathways, which include plsY function, can lead to controlled bacterial lysis and enhanced antigen presentation .

  • Expression of heterologous antigens:

    • The cellular machinery for glycerolipid synthesis is part of the metabolic network that supports heterologous antigen expression in recombinant Salmonella strains .

    • Maintaining cell envelope integrity, which depends on proper phospholipid synthesis via plsY function, is crucial for effective antigen delivery by recombinant Salmonella .

  • Optimization of immune responses:

    • Bacterial membrane components, including phospholipids synthesized via the plsY pathway, can stimulate innate immune responses and function as adjuvants .

    • The balance of membrane components affects bacterial fitness during host colonization, which impacts vaccine efficacy .

Recombinant attenuated Salmonella vaccine development typically employs strategies such as:

  • Balanced-lethal systems using plasmids encoding protective antigens

  • Regulated delayed attenuation to enhance safety while preserving immunogenicity

  • Programmed bacterial lysis systems for antigen release

  • Secretion of heterologous antigens using type II secretion signals

These approaches focus on engineering a controlled bacterial infection that effectively delivers antigens to the host immune system while maintaining safety .

What are the challenges in maintaining plasmid stability when expressing recombinant plsY in vaccine strains?

Maintaining plasmid stability when expressing recombinant plsY or other proteins in Salmonella vaccine strains presents several challenges:

  • Metabolic burden:

    • Expression of recombinant plsY creates a metabolic load that can reduce bacterial fitness and growth rate

    • This burden may select for plasmid-free variants during cultivation or after immunization

    • Research shows that recombinant Salmonella strains often need to be tested for plasmid stability through multiple generations (typically 80+ generations) to ensure reliable expression

  • Selection systems:

    • Traditional antibiotic selection markers are unsuitable for in vivo use

    • Balanced-lethal systems using essential genes like asd have been developed:

      • When the asd gene is deleted from the chromosome and provided on a plasmid, strains cannot grow without maintaining the plasmid

      • This creates a selective pressure that maintains plasmid retention in the absence of antibiotics

    • Example: The Asd+ plasmid system allows selection of transformants containing recombinant plasmids on media without diaminopimelic acid (DAP)

  • Plasmid design considerations:

    • Copy number: Lower copy number plasmids often show better stability but yield less recombinant protein

    • Promoter selection: Constitutive vs. inducible promoters affect both stability and expression levels

    • Plasmid size: Smaller plasmids generally show better stability

  • Experimental validation of stability:

    • In vitro stability testing: Daily passage with dilutions of 1:1,000 for five consecutive days, followed by protein expression analysis

    • In vivo stability assessment: Recovery of bacteria from immunized animals and verification of plasmid retention and protein expression

Example of successful plasmid stability in vaccine strain:
"SL7207 carrying pIRES-ureB-IIL-2 was grown in vitro up to 80 generations to examine the plasmid stability. The objective fragments (1.7 kb and 510 bp) could be seen on the map of agarose gel of PCR products and those of restriction enzyme digested recombinant plasmid isolated from transformed SL7207."

How can CRISPR-Cas9 technology be applied to study plsY function in Salmonella typhimurium?

CRISPR-Cas9 technology offers powerful approaches to study plsY function in Salmonella typhimurium:

  • Precise genetic manipulation strategies:

    • Knockout studies: Complete deletion of plsY to assess essentiality and phenotypic consequences when complemented with alternative lipid synthesis pathways

    • Point mutations: Introduction of specific mutations to study structure-function relationships, particularly in catalytic residues or substrate binding regions

    • Conditional expression: Creation of inducible knockdowns using CRISPRi (CRISPR interference) to modulate plsY expression levels without complete deletion

    • Tagged variants: Insertion of epitope or fluorescent tags for protein localization and interaction studies

  • Experimental design considerations:

    • Since plsY is likely essential for growth, CRISPR-based manipulations should include:

      • Conditional systems (e.g., arabinose-inducible promoters similar to those used for regulated lysis systems)

      • Complementation with orthologous genes during editing

      • Careful phenotypic assessment under various growth conditions

  • Practical methodology:

    • Design of sgRNAs targeting specific regions of the plsY gene

    • Delivery of CRISPR components via plasmids compatible with Salmonella

    • Selection strategies for identifying successful edits

    • Verification of genomic modifications using sequencing

  • Functional characterization approaches:

    • Lipidomic analysis to assess changes in membrane phospholipid composition

    • Growth kinetics under various conditions to identify conditional phenotypes

    • Bacterial fitness and competitive index studies in various environments

    • Combination with other genetic modifications to study pathway interactions

This technology allows researchers to address sophisticated questions about plsY function, such as identifying residues critical for substrate specificity, regulatory mechanisms, and interactions with other components of the lipid synthesis machinery.

What are the current hypotheses about the evolutionary relationship between bacterial plsY and eukaryotic GPATs?

Current hypotheses regarding the evolutionary relationship between bacterial plsY and eukaryotic GPATs reveal a complex history of functional convergence despite structural divergence:

  • Independent evolutionary origins hypothesis:

    • Bacterial plsY and eukaryotic GPATs show minimal sequence homology despite catalyzing similar reactions

    • Structural analysis suggests they evolved independently to perform analogous functions

    • This represents a case of convergent evolution driven by the fundamental requirement for glycerolipid synthesis in all cellular life

  • Functional diversification hypothesis:

    • While the primary acyltransferase function is conserved, significant diversification has occurred in:

      • Substrate specificity (acyl-CoA chain length preferences)

      • Regiospecificity (sn-1 vs. sn-2 acylation)

      • Presence of additional functional domains (e.g., phosphatase activity in plant GPATs)

  • Environmental adaptation hypothesis:

    • Specialized activities of different GPAT families reflect adaptation to specific ecological niches

    • Land plant-specific GPATs with sn-2 regiospecificity and phosphatase activity appear to have evolved specifically for the production of extracellular lipid barriers (cutin and suberin)

    • This adaptation may have been crucial for plant colonization of terrestrial environments

  • Phylogenetic distribution evidence:

    • The land-plant-specific GPAT family with sn-2 acylation and phosphatase activity is absent in animals, fungi, and microorganisms (including algae)

    • This distinctive evolutionary pattern suggests these enzymes arose after the divergence of land plants from algal ancestors

What are common challenges in expressing active recombinant plsY and how can they be addressed?

Researchers frequently encounter several challenges when expressing active recombinant Salmonella typhimurium plsY:

  • Protein solubility issues:

    • Challenge: As a membrane protein, plsY often aggregates and forms inclusion bodies.

    • Solutions:

      • Lower induction temperature (16-20°C)

      • Reduce inducer concentration

      • Use fusion partners that enhance solubility (e.g., MBP, SUMO)

      • Express in specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane proteins

      • Consider cell-free expression systems for difficult proteins

  • Low enzymatic activity:

    • Challenge: Recombinant plsY often shows reduced activity compared to native enzyme.

    • Solutions:

      • Optimize detergent type and concentration for extraction (e.g., n-dodecyl-β-D-maltoside at 1-2%)

      • Include stabilizing agents like glycerol (up to 50%) in purification buffers

      • Test different affinity tags and their positions (N-terminal vs. C-terminal)

      • Verify proper folding using circular dichroism or limited proteolysis

  • Expression level variability:

    • Challenge: Inconsistent expression levels between experiments.

    • Solutions:

      • Standardize culture conditions (media composition, cell density at induction)

      • Verify plasmid stability over multiple generations

      • Consider codon optimization for expression host

      • Test different promoter systems (constitutive vs. inducible)

  • Activity assay interference:

    • Challenge: Buffer components or purification additives interfere with activity measurements.

    • Solutions:

      • Include appropriate controls to account for background activity

      • Dialyze or use desalting columns to remove interfering components

      • Optimize assay conditions (pH, salt concentration, presence of detergents)

      • Consider alternative assay methods if interference persists

Practical example: The successful expression of recombinant Salmonella proteins has been achieved in the Asd+ plasmid system, where transformants containing the plasmids were selected on LB agar plates without diaminopimelic acid (DAP). Only clones containing recombinant plasmids were able to grow under these conditions, providing both selection and stability .

What analytical methods can resolve contradictory data in plsY enzymatic characterization studies?

When faced with contradictory data in plsY enzymatic characterization studies, researchers can employ several analytical methods to resolve discrepancies:

  • Orthogonal activity assay approaches:

    • Application: When different activity measurement methods yield inconsistent results.

    • Methods:

      • Compare radioisotope-based assays with HPLC-based product detection

      • Validate with mass spectrometry to directly identify and quantify reaction products

      • Employ enzyme-coupled spectrophotometric assays for continuous monitoring

    • Resolution outcome: Identifies method-specific artifacts or interferences

  • Protein quality assessment:

    • Application: When batch-to-batch variation leads to activity differences.

    • Methods:

      • Size-exclusion chromatography to assess aggregation state

      • Thermal shift assays to evaluate protein stability

      • Mass spectrometry to confirm protein integrity and post-translational modifications

      • Circular dichroism to verify proper folding

    • Resolution outcome: Distinguishes true enzymatic properties from artifacts of protein preparation

  • Comprehensive substrate and condition screening:

    • Application: When conflicting substrate preferences are reported.

    • Methods:

      • Systematic variation of substrate concentrations for accurate Km determination

      • pH-activity profiling across broad range (pH 5-9)

      • Testing of various divalent cations and concentrations

      • Detergent screen to optimize enzyme-micelle interactions

    • Resolution outcome: Identifies condition-dependent activity variations that may explain discrepancies

  • Advanced kinetic analysis:

    • Application: When simple Michaelis-Menten kinetics fail to explain observations.

    • Methods:

      • Progress curve analysis to detect product inhibition or substrate depletion effects

      • Global fitting of multiple datasets to complex kinetic models

      • Isothermal titration calorimetry for direct binding measurements

      • Surface plasmon resonance for real-time interaction analysis

    • Resolution outcome: Reveals complex kinetic behaviors masked in endpoint assays

Example of resolving contradictory data: When examining the properties of Salmonella typhimurium sn-glycerol-3-phosphate transport system, researchers found apparent discrepancies in Km values. By systematically comparing assay conditions and using multiple measurement approaches, they determined that the system exhibited an apparent Km of 50 μM and a Vmax of 2.2 nmol/min per 10^8 cells in fully induced cells, differing from the E. coli system which showed a Km of 14 μM .

How might targeting plsY be exploited for antimicrobial development against Salmonella infections?

Targeting plsY presents promising opportunities for novel antimicrobial development against Salmonella infections:

  • Rationale for plsY as an antimicrobial target:

    • Essential role in bacterial membrane phospholipid synthesis

    • No human homolog with significant sequence similarity, reducing off-target effects

    • Conserved across many bacterial pathogens, offering broad-spectrum potential

    • Located in the bacterial membrane, providing accessibility to drug molecules

  • Potential inhibition strategies:

    • Competitive substrate analogs:

      • Development of acyl-CoA or G3P structural mimics that compete for the active site

      • Nonhydrolyzable acyl-phosphopantetheine analogs that bind irreversibly

    • Allosteric inhibitors:

      • Small molecules that bind to regulatory sites and induce conformational changes

      • Peptide-based inhibitors targeting protein-protein interaction interfaces

    • Covalent modifiers:

      • Compounds that react with catalytic residues in the active site

      • Photoaffinity labels for irreversible inhibition

  • Drug discovery approaches:

    • Structure-based design:

      • Homology modeling based on related bacterial acyltransferases

      • Virtual screening of compound libraries against predicted binding sites

    • High-throughput screening:

      • Development of cell-based assays measuring bacterial growth inhibition

      • Biochemical assays using purified recombinant plsY to identify direct inhibitors

    • Natural product exploration:

      • Screening of microbial extracts for selective plsY inhibitors

      • Modification of existing natural product scaffolds

  • Delivery strategies:

    • Conjugation to siderophores for active bacterial uptake

    • Encapsulation in nanoparticles for enhanced delivery

    • Formulation with membrane-disrupting agents for improved access

Preliminary evidence for this approach comes from studies with the antibiotic fosfomycin, where resistance mapping identified glpT (involved in G3P transport) as a resistance locus at 47 min in the S. typhimurium linkage map . This suggests that modulation of the G3P pathway, which includes plsY, can affect bacterial survival and antibiotic susceptibility.

What potential applications exist for engineered plsY variants with altered substrate specificity?

Engineered plsY variants with altered substrate specificity offer exciting applications in both fundamental research and biotechnology:

  • Production of novel phospholipids with tailored properties:

    • Research application: Creating bacterial membranes with unusual fatty acid compositions to study membrane biophysics

    • Biotechnological application: Generating custom phospholipids for pharmaceutical formulations, cosmetics, and food science

    • Methodology: Rational design of the acyl-binding pocket to accommodate non-natural or uncommon fatty acids

  • Metabolic engineering for biofuel and oleochemical production:

    • Research application: Studying bottlenecks in lipid biosynthetic pathways

    • Biotechnological application: Creating bacterial strains that produce high-value lipids or biofuel precursors

    • Methodology: Engineering plsY to preferentially incorporate specific fatty acids into the lipid biosynthesis pathway, potentially coupled with engineered fatty acid synthesis pathways

  • Synthetic biology applications:

    • Research application: Creating minimal cells with defined membrane compositions

    • Biotechnological application: Developing bacterial chassis with customized membrane properties for specific industrial processes

    • Methodology: Integration of engineered plsY variants into synthetic gene circuits that respond to environmental signals

  • Enhanced vaccine development:

    • Research application: Studying how membrane composition affects immunogenicity

    • Biotechnological application: Creating recombinant attenuated Salmonella vaccines with optimized membrane properties

    • Methodology: Engineering plsY to alter membrane composition in vaccine strains to enhance stimulation of innate immune responses

  • Tools for studying lipid-protein interactions:

    • Research application: Investigating how specific lipids influence membrane protein function

    • Biotechnological application: Developing optimized expression systems for membrane proteins

    • Methodology: Creating bacterial strains with modified plsY that produce membranes enriched in specific phospholipids to study their effects on protein stability and function

Experimental approaches might include directed evolution of plsY using error-prone PCR or DNA shuffling, followed by selection or screening for variants with desired substrate preferences. Alternatively, rational design based on structural models could target specific residues in the substrate-binding pocket for site-directed mutagenesis.

These applications build on our understanding of how existing plant GPATs have evolved diverse functions, including the ability to acylate different positions (sn-1 vs. sn-2) and recognize various acyl-CoA substrates .

How can interdisciplinary collaboration enhance research on Salmonella typhimurium plsY?

Interdisciplinary collaboration can significantly enhance research on Salmonella typhimurium plsY by bringing together diverse expertise to address complex questions:

  • Structural biology and computational approaches:

    • Collaborative opportunity: Partnership between X-ray crystallographers, cryo-EM specialists, and computational modelers

    • Research objective: Determine high-resolution structure of plsY and model substrate binding

    • Expected outcome: Insights into catalytic mechanism and rational design of inhibitors

    • Methodological synergy: Integration of experimental structural data with molecular dynamics simulations

  • Synthetic biology and metabolic engineering:

    • Collaborative opportunity: Collaboration between bacterial geneticists and metabolic engineers

    • Research objective: Engineer Salmonella strains with modified lipid compositions

    • Expected outcome: Bacteria with novel membrane properties for biotechnological applications

    • Methodological synergy: Combining genetic circuit design with metabolic flux analysis

  • Immunology and vaccine development:

    • Collaborative opportunity: Partnership between microbiologists and immunologists

    • Research objective: Optimize recombinant Salmonella vaccines utilizing plsY knowledge

    • Expected outcome: Enhanced vaccine efficacy through improved membrane composition

    • Methodological synergy: Combining bacterial genetics with immunological assays to assess vaccine efficacy

  • Systems biology and bioinformatics:

    • Collaborative opportunity: Collaboration between experimentalists and computational biologists

    • Research objective: Map the regulatory networks controlling plsY expression

    • Expected outcome: Comprehensive understanding of how lipid synthesis responds to environmental changes

    • Methodological synergy: Integration of transcriptomic, proteomic, and metabolomic data with network modeling

  • Medicinal chemistry and microbiology:

    • Collaborative opportunity: Partnership between chemists and microbiologists

    • Research objective: Develop selective inhibitors of plsY

    • Expected outcome: Novel antimicrobial candidates effective against Salmonella

    • Methodological synergy: Iterative compound synthesis guided by biological testing

Successful interdisciplinary collaboration requires:

  • Shared research facilities and resources

  • Regular communication across disciplinary boundaries

  • Development of common language and understanding

  • Integration of data across different experimental approaches

What key questions about plsY remain unanswered and require multidisciplinary approaches?

Several fundamental questions about Salmonella typhimurium plsY remain unanswered and would benefit from multidisciplinary approaches:

  • Structural basis of catalysis and substrate recognition:

    • Unanswered question: What is the complete three-dimensional structure of plsY and how does it change during catalysis?

    • Required disciplines: Structural biology, computational modeling, enzymology, biophysics

    • Methodological approach: Integration of cryo-EM, X-ray crystallography, molecular dynamics simulations, and enzyme kinetics

    • Significance: Would enable rational design of inhibitors and engineering of substrate specificity

  • Regulatory networks controlling plsY expression:

    • Unanswered question: How is plsY expression regulated in response to environmental conditions and stress?

    • Required disciplines: Systems biology, microbiology, molecular genetics, bioinformatics

    • Methodological approach: Transcriptomic and proteomic profiling under various conditions, ChIP-seq to identify regulatory elements, network analysis

    • Significance: Would reveal how bacteria modulate membrane composition during infection and stress

  • Role of plsY in bacterial pathogenesis and host-pathogen interactions:

    • Unanswered question: How do plsY-dependent changes in membrane composition affect Salmonella virulence and immune evasion?

    • Required disciplines: Immunology, microbiology, lipidomics, cell biology

    • Methodological approach: Controlled expression of plsY variants in infection models, lipidomic analysis of membrane changes, immune response profiling

    • Significance: Could identify novel targets for therapeutic intervention and vaccine development

  • Evolutionary relationship between bacterial plsY and eukaryotic GPATs:

    • Unanswered question: Did bacterial plsY and eukaryotic GPATs evolve from a common ancestor or represent convergent evolution?

    • Required disciplines: Evolutionary biology, comparative genomics, structural biology, biochemistry

    • Methodological approach: Comprehensive phylogenetic analysis, ancestral sequence reconstruction, biochemical characterization of predicted ancestral enzymes

    • Significance: Would provide insights into the evolution of lipid metabolism across domains of life

  • Integration of plsY into bacterial metabolic networks:

    • Unanswered question: How is plsY activity coordinated with other metabolic pathways during growth and stress?

    • Required disciplines: Metabolomics, fluxomics, mathematical modeling, molecular biology

    • Methodological approach: Metabolic flux analysis using isotope labeling, development of kinetic models, experimental validation through genetic manipulation

    • Significance: Would reveal how lipid synthesis is balanced with other metabolic demands

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.