Recombinant Salmonella typhimurium Histidine transport system permease protein hisQ (hisQ)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella typhimurium Histidine Transport System Permease Protein HisQ (HisQ)

The recombinant HisQ protein is a membrane-bound permease component of the histidine ABC transport system in Salmonella typhimurium. This system enables the uptake of histidine, lysine, arginine, and ornithine, playing a critical role in bacterial nutrition and adaptation to environments with limited amino acid availability . HisQ functions alongside HisM (another membrane protein), HisJ (periplasmic histidine-binding protein), and HisP (ATP-binding subunit) to form a functional transporter complex .

Production and Purification

Recombinant HisQ is typically expressed in E. coli with an N-terminal His-tag for purification via affinity chromatography . Post-purification, the protein is lyophilized and stored at -20°C or -80°C to maintain stability . Reconstitution experiments have demonstrated that HisQ can be separated from HisP and reassembled in vitro, confirming the modular nature of the transporter .

ATP Dependence and Transport Dynamics

  • Energy Coupling: HisQ-mediated transport requires ATP hydrolysis by HisP, which is activated by the binding of HisJ to histidine .

  • Inhibitor Sensitivity: Vanadate inhibits transport, confirming ATP utilization as the energy source .

  • Kinetics: Interaction between HisJ and the HisQ/HisM complex follows Michaelis-Menten kinetics (K₁/₂ ≈ 65 µM) .

Applications in Scientific Research

ApplicationDescriptionSource
Transporter MechanismStudying substrate specificity and ATP-dependent conformational changes
Membrane ProteinReconstitution in liposomes to analyze protein-lipid interactions
Vaccine DevelopmentPotential antigen for targeting bacterial transport systems in pathogenic strains

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
hisQ; STM2353; Histidine transport system permease protein HisQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
hisQ
Target Protein Sequence
MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVTGLIFEGYTTLIRGVP DLVLMLLIFYGLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP KGHIEAATAFGFTHGQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT QLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVGVKRADL
Uniprot No.

Target Background

Function
This protein is part of the histidine permease ABC transporter and also part of a lysine/arginine/ornithine transporter. It is likely responsible for the translocation of the substrate across the membrane. HisQ is essential for relaying the ATPase-inducing signal from the solute-binding protein to HisP.
Gene References Into Functions
  1. The functional role of each HisQ domain in the catalytic transport cycle has been described. PMID: 24021237
Database Links

KEGG: stm:STM2353

STRING: 99287.STM2353

Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the histidine transport system permease protein hisQ in Salmonella typhimurium?

The histidine transport system permease protein hisQ is an integral membrane component of the histidine ABC transporter complex in Salmonella typhimurium. It functions as part of the histidine transport system that facilitates the uptake of histidine across the bacterial cell membrane. The protein belongs to the larger family of ABC (ATP-binding cassette) transporters, which use energy from ATP hydrolysis to transport various substrates. In Salmonella typhimurium, the histidine transport system is crucial for bacterial survival in environments where histidine availability is limited, making it an important factor in bacterial metabolism and potentially in pathogenicity.

What are the established methods for generating recombinant Salmonella typhimurium strains expressing modified hisQ?

Several established methods exist for generating recombinant Salmonella typhimurium strains with modified hisQ proteins. Similar to approaches used for other Salmonella proteins, researchers can employ recombinant DNA techniques to add tags to hisQ, as demonstrated in protein interaction studies with other Salmonella proteins. A histidine-biotin-histidine (HBH) tagging approach has proven successful for other Salmonella proteins and could be adapted for hisQ . This method involves:

  • Constructing expression vectors containing the hisQ gene with appropriate tags

  • Transforming these constructs into Salmonella typhimurium

  • Selecting transformants using appropriate antibiotic markers

  • Verifying expression using Western blot analysis

The addition of such tags facilitates subsequent purification and interaction studies while maintaining protein functionality.

How can researchers verify the expression and functionality of recombinant hisQ protein?

Verification of recombinant hisQ expression and functionality requires a multi-faceted approach:

  • Western blot analysis: Using antibodies against either the hisQ protein itself or against added tags (such as histidine tags) to confirm protein expression. Western blot analysis with varying formaldehyde concentrations (0.5-3%) can help optimize cross-linking conditions .

  • Functional complementation: Testing whether the recombinant hisQ can restore histidine transport in hisQ-deficient strains.

  • Transport assays: Measuring the uptake of radiolabeled histidine to confirm functionality of the transport system.

  • Growth assays: Comparing growth rates in histidine-limited media between wild-type and recombinant strains.

These approaches collectively provide strong evidence for both expression and functionality of the recombinant protein.

How can protein-protein interactions involving hisQ be investigated in vivo?

Investigating protein-protein interactions involving hisQ in vivo requires specialized approaches due to its membrane-bound nature. Based on established methodologies for Salmonella proteins, the following protocol can be adapted for hisQ research:

  • In vivo cross-linking with formaldehyde: This stabilizes protein interactions in their native cellular environment. Optimization of formaldehyde concentration (typically 0.5-3%) is critical for effective cross-linking without excessive protein aggregation .

  • Tandem affinity purification under denaturing conditions: For membrane proteins like hisQ, denaturing conditions help solubilize the protein while maintaining cross-linked interactions. The histidine-biotin-histidine tag system allows for sequential purification steps:

    • Initial purification using Ni-NTA agarose

    • Secondary purification using immobilized streptavidin

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS): This identifies proteins cross-linked to hisQ with high sensitivity and specificity.

  • Negative controls: Two different negative controls should be employed to eliminate background and non-specific interactions, particularly important for membrane proteins which tend to have higher non-specific binding .

This methodology effectively reduces non-specific binding of non-cross-linked proteins to the bait proteins, a significant issue in membrane protein interaction studies.

What immune response mechanisms might be triggered by recombinant Salmonella typhimurium expressing hisQ?

Based on immunological studies of other Salmonella proteins, recombinant S. typhimurium expressing hisQ might trigger several immune response mechanisms:

This complex immune response profile is important to consider when designing hisQ-based vaccine vectors or studying host-pathogen interactions.

What methodological challenges exist when studying membrane topology of hisQ?

Studying the membrane topology of hisQ presents several methodological challenges that require specialized approaches:

  • Protein solubilization: As an integral membrane protein, hisQ requires careful selection of detergents or other solubilizing agents to maintain native structure while allowing experimental manipulation.

  • Epitope accessibility: Tags used for detection may be inaccessible depending on their location within the membrane-spanning regions.

  • Protein orientation determination: Methods such as protease protection assays, reporter fusions (PhoA/LacZ), and substituted cysteine accessibility method (SCAM) can help determine the orientation of different protein domains relative to the membrane.

  • Structural analysis limitations: Traditional structural biology techniques like X-ray crystallography are challenging for membrane proteins, often requiring specialized approaches like electron microscopy or NMR spectroscopy of reconstituted proteins.

  • Expression system selection: The choice between homologous (Salmonella) or heterologous (E. coli, CHO cells) expression systems impacts protein folding and insertion into membranes. While CHO cells have been successfully used for expressing Salmonella proteins , careful validation of proper membrane insertion is required.

What purification strategies are most effective for recombinant hisQ protein?

Effective purification of recombinant hisQ protein requires strategies optimized for membrane proteins:

  • Two-step affinity purification:

    • Primary purification using Ni-NTA agarose for histidine-tagged proteins

    • Secondary purification using immobilized streptavidin for biotin-tagged proteins

  • Denaturing conditions: Using denaturing agents (like SDS) throughout purification helps solubilize membrane proteins while maintaining protein-protein interactions if they have been stabilized by cross-linking .

  • Purification verification: Western blot analysis with anti-RGSHis antibody can confirm successful purification, as demonstrated for other Salmonella proteins .

The table below summarizes optimization parameters for hisQ purification based on approaches used with other membrane proteins:

ParameterRecommended ConditionConsiderations
Cross-linking agentFormaldehyde (0.5-3%)Concentration requires optimization
Primary affinity resinNi-NTA agaroseFor histidine-tagged proteins
Secondary affinity resinImmobilized StreptavidinFor biotin-tagged proteins
DetergentSDSEffective for membrane protein solubilization
Buffer conditionsDenaturingPrevents aggregation and non-specific binding
Elution methodCompetitive elutionUsing imidazole for His-tag, biotin for streptavidin

How can researchers differentiate between specific and non-specific interactions in hisQ studies?

Differentiating between specific and non-specific interactions is critical in hisQ research, particularly because membrane proteins are prone to non-specific associations. Based on established methodologies, researchers should implement:

  • Multiple negative controls:

    • Untagged wild-type strain processed identically to tagged strains

    • Non-relevant tagged protein expressed in the same system

    • This dual control approach effectively eliminates background and non-specific proteins from consideration

  • Reciprocal co-immunoprecipitation: Confirming interactions by pulldowns from both directions (using hisQ as bait and then using the identified partner as bait)

  • Competitive binding assays: Using excess unlabeled protein to displace specific interactions

  • Gradient cross-linking: Performing experiments with increasing cross-linker concentrations to differentiate between high-affinity (persistent at low concentrations) and low-affinity (requiring higher concentrations) interactions

  • Statistical analysis: Applying appropriate statistical methods to distinguish true interactions from random associations

What approaches can assess the functional impact of hisQ mutations on histidine transport?

Assessment of the functional impact of hisQ mutations requires complementary approaches:

  • Transport assays:

    • Measuring uptake of radiolabeled histidine in wild-type versus mutant strains

    • Determining kinetic parameters (Km, Vmax) to quantify transport efficiency

    • Comparing transport rates under various environmental conditions

  • Growth phenotype analysis:

    • Evaluating growth in histidine-limited media

    • Monitoring competitive fitness with wild-type strains

    • Assessing growth under different stress conditions

  • Protein expression and localization verification:

    • Western blot analysis to confirm mutant protein expression

    • Membrane fractionation to verify proper localization

    • Fluorescent protein fusions to visualize cellular distribution

  • Interaction studies with other transport system components:

    • Co-immunoprecipitation to assess changes in protein-protein interactions

    • Cross-linking studies followed by mass spectrometry identification

    • Bacterial two-hybrid assays for interaction mapping

  • Structural analysis:

    • Circular dichroism to assess secondary structure changes

    • Limited proteolysis to evaluate conformational differences

    • In silico modeling based on homologous proteins

How can mass spectrometry be optimized for studying hisQ and its interaction partners?

Optimizing mass spectrometry for hisQ research requires specialized approaches for membrane proteins:

  • Sample preparation:

    • Efficient cross-linking using formaldehyde (0.5-3%) to stabilize interactions

    • Tandem affinity purification under denaturing conditions to reduce non-specific binding

    • Protease digestion optimization (trypsin, chymotrypsin, or combination) for improved peptide coverage

  • Chromatography considerations:

    • Hydrophobic interaction chromatography to handle membrane-derived peptides

    • Longer chromatographic gradients for better separation of complex samples

    • Specialized columns designed for hydrophobic peptides

  • Mass spectrometry settings:

    • Data-dependent acquisition with exclusion lists to focus on lower-abundance peptides

    • Multiple fragmentation methods (CID, HCD, ETD) for comprehensive coverage

    • Targeted approaches (SRM/MRM) for quantitative analysis of specific interactions

  • Data analysis:

    • Cross-linking-specific search algorithms

    • Label-free quantification for comparing interaction strengths

    • Statistical validation through multiple replicates and appropriate controls

  • Validation strategy:

    • Orthogonal techniques (co-IP, FRET) to confirm MS-identified interactions

    • Directed mutagenesis of interaction sites identified by MS

    • Functional assays to assess biological relevance of interactions

What immune response analysis methods are most informative for hisQ research?

Based on immune response studies with other Salmonella proteins, the following methods would be most informative for hisQ research:

  • T cell response analysis:

    • Flow cytometry to detect antigen-specific CD8+ T cell frequency, which has proven more reliable than CD4+ T cell responses in Salmonella studies

    • ELISPOT assays to quantify IFN-γ-producing cells in response to recombinant proteins

  • Cytokine profiling:

    • ELISA for measuring cytokine production in response to recombinant hisQ

    • Multiplex cytokine analysis to simultaneously measure multiple inflammatory mediators

  • HLA typing and restriction analysis:

    • HLA typing of research subjects, particularly for HLA-B27 which shows strong association with Salmonella-triggered reactive arthritis

    • Testing in different HLA-transfected cell lines to determine restriction patterns

  • Cross-reactivity assessment:

    • Testing for cross-reactivity between hisQ and host proteins

    • Epitope mapping to identify immunodominant regions

  • Comparative analysis across patient groups:

    • Stratification of immune responses by HLA type, as demonstrated in previous Salmonella studies where 82% of responders were HLA-B27 positive

    • Comparison between different disease states (acute infection vs. chronic conditions)

How should researchers address inconsistent expression levels of recombinant hisQ?

Inconsistent expression of recombinant hisQ can significantly impact experimental outcomes. Researchers should systematically address this issue through:

  • Optimization of expression system:

    • Testing different promoters (constitutive vs. inducible)

    • Evaluating various host strains (lab strains vs. clinical isolates)

    • Adjusting induction parameters (concentration, timing, temperature)

  • Codon optimization:

    • Analyzing the hisQ sequence for rare codons

    • Designing codon-optimized synthetic genes for the expression host

    • Using specialized strains with rare tRNA supplementation

  • Toxicity assessment:

    • Monitoring growth curves of expression strains

    • Testing leaky expression in uninduced cultures

    • Using tightly regulated expression systems for toxic proteins

  • Protein stability considerations:

    • Adding protease inhibitors during sample processing

    • Testing different harvest time points

    • Evaluating the impact of different tags on protein stability

  • Standardization approaches:

    • Implementing robust quantification methods

    • Establishing internal controls for normalization

    • Developing standard operating procedures for consistent processing

What controls are essential when studying hisQ-host cell interactions?

When studying interactions between hisQ-expressing Salmonella and host cells, essential controls include:

  • Bacterial strain controls:

    • Wild-type S. typhimurium (positive control)

    • hisQ knockout strains (negative control)

    • Strains expressing non-relevant recombinant proteins (specificity control)

  • Host cell controls:

    • Uninfected cells processed identically to infected cells

    • Cells infected with control bacteria lacking recombinant proteins

    • Cells transfected with appropriate restriction molecules when studying MHC-restricted responses

  • Methodological controls:

    • Mock-treated samples for each experimental manipulation

    • Biological replicates from independent bacterial cultures

    • Technical replicates to assess methodological variation

  • Positive controls for detection systems:

    • Known bacterial antigens that trigger specific responses

    • Direct addition of synthetic peptides for T cell stimulation experiments

    • Well-characterized protein-protein interactions for interaction studies

  • Time course controls:

    • Sampling at multiple time points to distinguish transient from stable interactions

    • Parallel processing of samples to minimize batch effects

How might CRISPR-Cas9 technologies enhance hisQ research?

CRISPR-Cas9 technologies offer transformative possibilities for hisQ research:

  • Precise genetic modifications:

    • Generation of clean deletions or point mutations without antibiotic markers

    • Introduction of tags at endogenous loci to maintain native expression levels

    • Creation of conditional knockouts for essential genes

  • High-throughput functional genomics:

    • Genome-wide screens to identify genes affecting hisQ function

    • Multiplexed mutagenesis to systematically analyze functional domains

    • Pooled screens in infection models to identify in vivo relevance

  • Regulatory element analysis:

    • CRISPRi for repression of hisQ expression without genetic modification

    • CRISPRa for enhancing expression to study overexpression phenotypes

    • Targeting of non-coding regions to study regulatory elements

  • Host-pathogen interaction studies:

    • Modifying host cell receptors or pathways to study their interaction with hisQ

    • Creating reporter cell lines to monitor hisQ-triggered responses

    • Engineering resistance/susceptibility factors in model organisms

  • Therapeutic applications:

    • Development of attenuated vaccine strains with precisely modified hisQ

    • Creation of bacterial delivery systems for heterologous antigens

    • Engineering strains with altered immunogenicity profiles

What unanswered questions remain about hisQ structure-function relationships?

Several critical questions about hisQ structure-function relationships remain to be addressed:

  • Structural determinants of substrate specificity:

    • How does hisQ differentiate between histidine and structurally similar amino acids?

    • Which residues form the binding pocket and transport channel?

    • How do conformational changes facilitate transport across the membrane?

  • Interaction network within the transport complex:

    • What is the stoichiometry of the complete histidine transport complex?

    • How does hisQ interact with other components of the ABC transporter system?

    • Which domains are responsible for protein-protein interactions versus substrate transport?

  • Regulatory mechanisms:

    • How is hisQ expression regulated in response to histidine availability?

    • What post-translational modifications affect hisQ function?

    • How do environmental signals modulate transport activity?

  • Evolutionary considerations:

    • How conserved is hisQ across Salmonella serovars and related bacterial species?

    • What selective pressures have shaped hisQ evolution?

    • Can evolutionary patterns reveal functional constraints?

  • Immunological significance:

    • Does hisQ contain immunodominant epitopes recognized by the host immune system?

    • How does hisQ contribute to bacterial survival in the host environment?

    • Could hisQ be targeted for vaccine development or antimicrobial therapy?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.