Recombinant Salmonella typhimurium Inner membrane protein yejM (yejM)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties of Recombinant YejM

Recombinant YejM is typically expressed in E. coli with an N-terminal His tag for purification . Key specifications include:

  • Molecular weight: ~66 kDa (theoretical).

  • Purity: >90% by SDS-PAGE .

  • Stability: Lyophilized powder stored at -80°C; reconstitution in Tris/PBS buffer with 6% trehalose .

Enzymatic Activity:

  • Demonstrates magnesium-dependent phosphatase activity linked to OM lipid regulation .

  • Active site residues (e.g., F349) and the arginine-rich linker are essential for function .

Functional Roles and Mechanisms

YejM is indispensable for bacterial viability and virulence through two primary pathways:

Lipid Homeostasis

  • Binds cardiolipin and regulates its transport to the OM, enhancing bacterial survival under PhoPQ-activated conditions .

  • Modulates lipopolysaccharide (LPS) biosynthesis by stabilizing LpxC, a key enzyme in lipid A production .

Interaction with Proteolytic Complexes

  • Inhibits the YciM/FtsH protease complex, preventing excessive degradation of LpxC .

  • Deletion of YejM leads to hyperactivation of FtsH, causing lethal OM defects .

Research Applications

Recombinant YejM is utilized in:

  • Antibiotic resistance studies: YejM-deficient strains show hypersensitivity to vancomycin and detergents .

  • Structural biology: Crystallography studies to elucidate mechanisms of OM remodeling .

  • Drug discovery: Target validation for novel antimicrobials due to its essential role .

Outstanding Research Questions

  • Substrate specificity: The identity of YejM’s physiological phosphatase substrates remains unknown .

  • Mechanistic coupling: How enzymatic activity coordinates with OM lipid transport is unresolved .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
yejM; STM2228; Inner membrane protein YejM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-586
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
yejM
Target Protein Sequence
MVTHRQRYREKVSQMVSWGHWFALFNILLATLLGSRYLFVADWPTTLAGRIYSYLSIVGH FSFLVFATYLLILFPLTFIVMSQRLMRFLSAILATAGMTLLLIDSEVFTRFHLHLNPIVW ELVINPDQNEMARDWQLMFISVPVILLIEMLFATWSWQKLRSLTRRRHFARPLAAFFFVS FIASHLIYIWADANFYRPITMQRANLPLSYPMTARRFLEKHGLLDAQEYQRRLVEQGNPE AVSVQYPLSNLHYRDMGTGQNVLLITVDGLNYSRFEKQMPELATFAEQNIDFTRHMSSGN TTDNGIFGLFYGISPGYMDGVLSTRTPAALITALNQQGYQLGLFSSDGFASPLYRQALLS DFSMPAAQTQSDAQTASQWIDWLGRYAQEDNRWFSWISFNGTNIDDSNQKNFVKRYASAA SDVDAQINRVLNALREAGKFDNTVVIITAGRGIPLTPEENRFDWSQGHLQVPLVIHWPGT PAQRINVLTDHTDVMTTLMQRLLHVSTPANEYSQGQDIFTVPRRHNWVTAADGSTLAITT PQMTLVLNNNGHYQTYDLHGEKIKDQKPQLSLLLQVLTEEKRFIAN
Uniprot No.

Target Background

Gene References Into Functions
  1. This study presents the first crystal structure of the soluble periplasmic globular domain of PbgA. The analysis reveals that the globular domains of PbgA resemble the structures of the arylsulfatase protein family and contains a novel core hydrophobic pocket potentially responsible for binding and transporting cardiolipins. PMID: 27487745
Database Links

KEGG: stm:STM2228

STRING: 99287.STM2228

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the essential biological role of YejM in Salmonella typhimurium?

YejM is an inner membrane (IM) metalloenzyme critical for maintaining outer membrane (OM) asymmetry by regulating lipopolysaccharide (LPS) biosynthesis. It senses periplasmic LPS levels through its periplasmic domain and modulates proteolytic degradation of LpxC, the rate-limiting enzyme in lipid A biosynthesis . Deletion of yejM leads to lethal OM permeability defects due to unbalanced LPS synthesis, as demonstrated by suppressor mutations in lpxC or ftsH that restore viability . Methodologically, essentiality is confirmed through conditional knockout strains and complementation assays using plasmid-borne yejM .

What experimental systems are used to express recombinant YejM for functional studies?

Recombinant YejM is typically expressed in E. coli or Salmonella systems with codon optimization for improved solubility. Key protocols include:

  • Membrane extraction: Detergent-based solubilization (e.g., 1% DDM) followed by Ni-NTA affinity chromatography .

  • Domain engineering: Truncation of the flexible periplasmic linker (residues 191–240) to enhance crystallizability, as shown in construct YejM241-586 .

  • Activity assays: Phosphatase activity is measured using p-nitrophenyl phosphate (pNPP) with magnesium dependence, confirming its metalloenzyme function .

How is YejM’s interaction with LPS or cardiolipin validated experimentally?

  • Lipid-binding assays: Surface plasmon resonance (SPR) or liposome co-flotation with purified periplasmic domains (e.g., YejM241-586) .

  • Genetic suppression: yejM mutants with OM permeability defects are rescued by lpxC mutations, linking YejM activity to LPS regulation .

  • Mass spectrometry: Quantitative lipidomics of OM vesicles from yejM mutants shows reduced cardiolipin under PhoPQ activation .

How do researchers reconcile contradictory findings about YejM’s role in cardiolipin transport versus LPS regulation?

The controversy arises from two observations:

  • PhoPQ activation increases OM cardiolipin, requiring YejM .

  • yejM essentiality is independent of cardiolipin synthases, implicating LPS as the primary substrate .

Resolution strategies:

  • Conditional knockdowns: Test OM lipid composition in yejM depletion strains lacking cardiolipin synthases (e.g., clsABC mutants) .

  • Biochemical reconstitution: Measure YejM’s lipid transport activity in proteoliposomes with fluorescently tagged LPS/cardiolipin .

  • Structural analysis: Compare cardiolipin-binding pockets in YejM homologs (e.g., EptA) to identify functional motifs .

What structural biology approaches are used to study YejM’s mechanism?

Key advancements include:

Table 1: YejM Constructs for Crystallography

ConstructResiduesDiffraction ResolutionKey Findings
Full-length1–586Not achievedAggregate-prone in detergent
YejM191-586191–586DegradedFlexible linker disrupts crystallization
YejM241-586241–5861.8 ÅDimeric periplasmic domain; Mg²⁺-bound active site

Methodological insights:

  • Lipidic cubic phase (LCP) crystallization: Enables membrane protein crystal growth in a lipid-rich environment .

  • Anomalous scattering: Identifies metal ions (Mg²⁺/Mn²⁺) in the active site using X-ray fluorescence .

How does YejM’s phosphatase activity influence OM remodeling?

YejM’s periplasmic domain shares structural homology with arylsulfatases and contains a conserved metalloenzyme active site (Fig. 1A in ). Functional studies reveal:

  • Kinetic parameters: Kₘ = 2.1 mM for pNPP, with optimal activity at pH 7.5 and 10 mM Mg²⁺ .

  • Physiological substrates: Likely dephosphorylates LPS precursors (e.g., lipid IVA) based on structural docking .

  • Genetic validation: Alanine substitutions in catalytic residues (H349A, D412A) abolish activity and cause OM defects .

How are yejM suppressor mutations analyzed to identify regulatory networks?

Suppressor screens in yejM mutants involve:

  • Random mutagenesis: Ethyl methanesulfonate (EMS) treatment to generate suppressors .

  • Whole-genome sequencing: Identify mutations in lpxC, ftsH, or lapB that restore OM integrity .

  • Transcriptional profiling: RNA-seq to assess PhoPQ regulon changes in suppressor strains .

What computational tools predict YejM’s interaction partners?

  • AlphaFold Multimer: Predicts YejM-LapB interactions via coiled-coil domains in the IM .

  • Molecular dynamics (MD): Simulates cardiolipin binding to YejM’s arginine-rich linker .

  • Phylogenetic profiling: Identifies co-evolved genes (e.g., lpxC, pbgA) across Enterobacteriaceae .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.