Recombinant Salmonella typhimurium Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; STM3410; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
mscL
Target Protein Sequence
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links

KEGG: stm:STM3410

STRING: 99287.STM3410

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Salmonella typhimurium Large-conductance mechanosensitive channel (mscL)?

The mscL protein is a membrane-embedded mechanosensitive channel that acts as a pressure relief valve in Salmonella typhimurium. It responds to mechanical stress in the bacterial cell membrane by forming a non-selective pore that allows rapid efflux of cytoplasmic solutes when bacteria experience hypoosmotic shock, thereby preventing cell lysis. The channel exists as a homopentameric complex embedded in the bacterial membrane and represents one of the most well-studied bacterial mechanosensitive channels due to its relatively simple structure yet sophisticated gating mechanism. Recombinant expression systems allow researchers to produce and purify this protein for detailed structural and functional studies.

Why is recombinant expression of mscL important in Salmonella research?

Recombinant expression of mscL provides several advantages for research:

  • It enables production of sufficient quantities of purified protein for structural studies, which would be difficult to obtain from native sources.

  • It allows for genetic manipulation through site-directed mutagenesis to study structure-function relationships.

  • It facilitates incorporation of tags (His-tags, fluorescent proteins) for purification and visualization.

  • It enables expression of the protein in heterologous systems for comparative analysis.

  • It serves as a model system for studying bacterial mechanosensation and osmotic regulation mechanisms that are crucial for pathogen survival.

How does the mscL protein function in bacterial osmoregulation?

The mscL channel remains closed under normal physiological conditions but opens in response to increased membrane tension during hypoosmotic shock. The opening mechanism involves a conformational change triggered by lateral tension in the lipid bilayer, creating a large pore (~30Å diameter) that allows non-selective passage of solutes up to 6.5 kDa, including ions, metabolites, and small proteins. This rapid release of cellular contents reduces turgor pressure, preventing cell lysis. The channel's activation threshold is calibrated to respond only during extreme osmotic stress, making it a critical emergency response system for bacterial survival.

What are the most effective expression systems for producing recombinant Salmonella typhimurium mscL?

Several expression systems have been optimized for recombinant mscL production:

  • E. coli-based systems: Most commonly used are BL21(DE3) strains with pET vectors under IPTG-inducible T7 promoters. For membrane proteins like mscL, specialized strains such as C41(DE3) or C43(DE3) often provide better yields by better accommodating membrane protein overexpression.

  • Expression conditions: Critical parameters include:

    • Temperature: Lower temperatures (16-25°C) improve proper folding

    • Inducer concentration: Reduced IPTG levels (0.1-0.5 mM) often improve yield

    • Media composition: Rich media (TB, 2XYT) can increase biomass

    • Induction timing: Induction at mid-log phase (OD600 ~0.6-0.8) typically works best

    • Duration: Extended expression periods (12-24 hours) at lower temperatures

  • Vector design considerations:

    • Fusion tags: N-terminal His6 tags facilitate purification while minimally affecting function

    • Fusion partners: MBP or SUMO fusions can improve solubility

    • Codon optimization: Adapting codons to expression host can improve yields

The choice of expression system should be guided by the downstream application requirements and the quantity and purity of protein needed.

What purification strategies work best for recombinant Salmonella typhimurium mscL?

Purifying membrane proteins like mscL requires specialized approaches:

  • Membrane isolation: After cell lysis, differential centrifugation separates membranes containing the expressed mscL protein.

  • Detergent solubilization: Critical step involving careful selection of detergents:

    • n-Dodecyl-β-D-maltopyranoside (DDM) is often preferred due to its mild nature

    • LDAO and OG are alternatives with different micelle properties

    • Detergent concentration must exceed CMC but remain as low as possible to avoid denaturation

  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Size exclusion chromatography to separate properly folded pentameric complexes from aggregates

    • Optional ion exchange chromatography for further purification

  • Quality control metrics:

    • SDS-PAGE analysis under both denaturing (boiled) and non-denaturing conditions

    • Western blotting with anti-His antibodies

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to verify secondary structure integrity

Table 1: Comparison of Detergents for mscL Purification

DetergentCMC (mM)Micelle Size (kDa)AdvantagesDisadvantages
DDM0.1770Mild, preserves activityLarge micelles
LDAO1-221.5Better for crystallizationMore denaturing
OG23-2425Easily dialyzedHigher protein loss
DM1.833Good compromiseModerate stability
Digitonin0.570-90Very mildExpensive, heterogeneous

How can the activity of recombinant mscL be assessed in vitro?

Functional characterization of purified mscL requires specialized techniques:

  • Proteoliposome reconstitution: Incorporating purified mscL into artificial liposomes with defined lipid composition. The protein-to-lipid ratio must be carefully controlled (typically 1:1000 to 1:5000 by weight) to ensure proper reconstitution without aggregation.

  • Electrophysiological measurements:

    • Patch-clamp recording of giant liposomes or planar lipid bilayers

    • Measurements should capture:

      • Single channel conductance (~3 nS in 200 mM KCl)

      • Tension threshold for activation (8-12 mN/m)

      • Subconductance states during gating

  • Fluorescence-based assays:

    • Calcein release assays: Self-quenching fluorescent dye entrapped in liposomes

    • FRET-based approaches using strategically placed fluorophores to monitor conformational changes

    • Environment-sensitive probes to detect structural rearrangements

  • Stopped-flow spectroscopy: Allows measurement of rapid kinetics of channel opening in response to osmotic downshock.

  • EPR spectroscopy: Site-directed spin labeling combined with EPR can provide information about conformational changes during gating.

What structural characterization methods are most informative for studying mscL conformational changes?

Several complementary approaches provide insights into mscL structure and dynamics:

  • X-ray crystallography: Has been challenging for full-length mscL due to its membrane protein nature, but has succeeded with certain constructs and can reveal atomic details of static states. Crystal structures of mscL from Mycobacterium tuberculosis and Staphylococcus aureus have provided valuable insights that can be applied to Salmonella typhimurium mscL through homology modeling.

  • Cryo-electron microscopy (cryo-EM): Has emerged as a powerful technique for membrane protein structure determination without crystallization requirements. Recent advances in direct electron detectors and image processing have made it possible to achieve near-atomic resolution of membrane proteins like mscL in different conformational states.

  • NMR spectroscopy: Solution NMR of detergent-solubilized mscL can provide dynamic information, though size limitations may require studying individual domains rather than the full pentameric complex.

  • Mass spectrometry approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) reveals solvent-accessible regions

    • Chemical crosslinking coupled with MS identifies residue proximities

    • Native MS can determine oligomeric state and lipid interactions

  • Integrative structural biology: Combining multiple low-resolution techniques with computational modeling to generate comprehensive structural models of the channel in different states.

How can mutagenesis approaches be optimized to study mscL structure-function relationships?

Systematic mutagenesis strategies have been valuable for understanding mscL:

  • Site-directed mutagenesis targeting functional regions:

    • Transmembrane helices: Mutations in the hydrophobic pore constriction (V23, G26, V30 in TM1) dramatically affect gating properties

    • Periplasmic loops: Affect channel tension sensitivity

    • Cytoplasmic helical bundle: Influences channel closing kinetics

  • Alanine-scanning mutagenesis: Systematic replacement of residues with alanine to identify critical functional positions.

  • Cysteine-scanning mutagenesis: Introduction of cysteines followed by chemical modification with:

    • Spin labels for EPR studies

    • Fluorescent probes for FRET analysis

    • Thiol-reactive compounds to test accessibility in different conformational states

  • Charge substitutions: Introduction of charged residues at specific positions can dramatically lower the tension threshold for activation (e.g., G22D mutation creates "gain-of-function" phenotypes).

  • Domain swapping: Creation of chimeric channels combining domains from different bacterial species can identify region-specific functional contributions.

Mutagenesis data should always be interpreted through both functional assays and structural analysis to establish mechanistic insights.

What are the major technical challenges in working with recombinant Salmonella typhimurium mscL, and how can they be addressed?

Researchers face several challenges when working with mscL:

  • Expression toxicity: Overexpression of membrane proteins often leads to cell growth inhibition and inclusion body formation.

    • Solution: Use tightly controlled expression systems with lower inducer concentrations and reduced temperatures (16-20°C).

    • Potential approach: Use bacterial strains with slower translation rates to improve folding.

  • Maintaining native oligomeric state: The pentameric assembly can dissociate during purification.

    • Solution: Careful detergent selection with extensive screening.

    • Advanced approach: Introduce disulfide bonds or use chemical crosslinking to stabilize the complex.

  • Functional reconstitution:

    • Challenge: Ensuring proper orientation and distribution in liposomes.

    • Solution: Optimize reconstitution protocols with careful control of detergent removal rates and lipid composition.

  • Distinguishing specific channel activity from non-specific membrane leakage:

    • Solution: Always include inactive mutant controls in functional assays.

    • Approach: Statistical analysis of single-channel recordings to distinguish channel events from artifacts.

  • Protein stability during long experiments:

    • Challenge: mscL can aggregate over time in detergent solutions.

    • Solution: Addition of glycerol (10-15%), use of fresh preparations, and storage at -80°C in small aliquots.

How do the properties of Salmonella typhimurium mscL compare with mscL channels from other bacterial species?

Comparative analysis reveals important insights:

Table 2: Comparative Properties of mscL from Different Bacterial Species

PropertyS. typhimurium mscLE. coli mscLM. tuberculosis mscL
Sequence identity100% (reference)98%37%
Protein length136 aa136 aa151 aa
Channel conductance~3.0 nS~3.0 nS~2.7 nS
Tension threshold10-12 mN/m10-12 mN/m11-13 mN/m
pH sensitivityModerateModerateHigh
C-terminal domainShorterShorterExtended
Key gating residuesV23, G26, V30V23, G26, V30I24, G27, I31

The high sequence conservation between Salmonella typhimurium and E. coli mscL (98% identity) results in very similar functional properties, while more distantly related channels like M. tuberculosis mscL show structural variations, particularly in the C-terminal domain, that correlate with functional differences. These comparative studies help identify conserved mechanisms essential for mechanosensation across species.

How can recombinant Salmonella typhimurium mscL be used as a model system for studying mechanotransduction?

The mscL channel provides an excellent model system for fundamental mechanotransduction research:

  • Direct force sensing: Unlike many eukaryotic mechanosensors, mscL responds directly to membrane tension without requiring accessory proteins, providing a "pure" system for studying mechanotransduction principles.

  • Quantitative biophysics: The relationship between applied tension and channel opening probability can be precisely measured, allowing development of mathematical models of force transduction in protein structures.

  • Structural transitions during gating: The large conformational change during channel opening (expanding from ~20Å to ~30Å in diameter) provides an excellent system for studying how physical forces drive protein structural rearrangements.

  • Lipid-protein interactions: Studies of how membrane composition affects mscL function reveal general principles about how membrane properties modulate protein function.

  • Evolutionary adaptation: Comparing mscL properties across species from different environments reveals how selective pressures shape mechanosensitive system properties.

These fundamental insights extend beyond bacterial systems to inform our understanding of mechanosensation in higher organisms, including humans.

How does recombinant mscL contribute to understanding Salmonella pathogenesis?

The study of mscL has implications for Salmonella pathogenesis research:

  • Osmotic survival during infection: Salmonella encounters varying osmotic environments during infection, from the hyperosmotic intestinal lumen to the isotonic intracellular environment of host cells. MscL may contribute to bacterial survival during these transitions .

  • Antibiotic susceptibility: Some antibiotics induce mechanical stress on bacterial membranes, and mechanosensitive channels can influence bacterial responses to these stresses. Understanding mscL function may reveal mechanisms of antibiotic tolerance.

  • Adaptation to host environments: Recombinant systems allow testing of how mscL function is affected by host-specific factors such as antimicrobial peptides and bile salts.

  • Potential vaccine applications: As demonstrated with other Salmonella membrane components, understanding mscL structure could contribute to vaccine development. Recombinant attenuated Salmonella expressing modified antigens has shown promise as a vaccine delivery platform .

  • Virulence regulation: Mechanosensing may play a role in detecting the mechanical properties of different host environments, potentially contributing to virulence gene regulation.

What is the role of lipid composition in modulating Salmonella typhimurium mscL function?

The lipid environment significantly influences mscL properties:

  • Membrane thickness effects: Hydrophobic matching between the transmembrane domains of mscL and the lipid bilayer affects:

    • Tension threshold for activation (thicker membranes require more tension)

    • Channel kinetics (slower opening/closing in thicker membranes)

    • Protein stability and oligomerization

  • Lipid headgroup effects:

    • Negatively charged lipids (PG, PS) decrease the tension threshold through electrostatic interactions

    • PE lipids with small headgroups create negative curvature stress that affects channel gating

    • Specific lipid-protein interactions can be identified through crystallography or mass spectrometry

  • Methodological considerations for research:

    • Reconstitution studies should consider using lipid compositions that mimic bacterial membranes (typically PE:PG:CL at approximately 70:25:5 ratio)

    • Systematic variation of lipid composition in proteoliposomes can reveal functional dependencies

    • Fluorescently labeled lipids can help track lipid-protein associations

  • Implications for drug development:

    • Compounds that alter membrane properties could indirectly affect mscL function

    • Targeting specific lipid-protein interactions could provide a novel approach to modulating channel function

How can computational approaches enhance our understanding of mscL dynamics and gating mechanisms?

Computational methods provide valuable insights into mscL function:

  • Molecular dynamics simulations:

    • All-atom simulations can model conformational changes during channel gating

    • Requirements include:

      • Accurate starting structures

      • Proper membrane representation

      • Sufficient simulation timescales (microseconds)

      • Appropriate force application methods to mimic membrane tension

  • Coarse-grained models:

    • Enable longer simulations at reduced computational cost

    • MARTINI force field is commonly used for membrane protein simulations

    • Can capture large-scale conformational changes during gating

  • Normal mode analysis:

    • Identifies intrinsic protein motions that may contribute to channel gating

    • Computationally efficient compared to MD simulations

    • Often reveals collective motions relevant to function

  • Machine learning approaches:

    • Can identify patterns in sequence-structure-function relationships across mechanosensitive channels

    • Useful for predicting effects of mutations on channel properties

    • Deep learning methods can help interpret complex experimental data

  • Integration with experimental data:

    • Simulations constrained by experimental measurements provide the most reliable insights

    • Iterative refinement of computational models based on experimental validation creates robust mechanistic models

What biotechnological applications are being developed based on recombinant mscL systems?

Research on recombinant mscL has inspired several biotechnological applications:

  • Controllable release systems:

    • Liposomes incorporating engineered mscL variants for stimulus-responsive drug delivery

    • Channels modified to respond to specific triggers (pH, light, temperature) rather than just mechanical force

    • Potential applications in targeted cancer therapy and precision medicine

  • Biosensors:

    • mscL-based sensors that detect mechanical forces or osmotic changes

    • Integration with electrical or optical reporting systems for real-time detection

    • Applications in environmental monitoring and bioprocess control

  • High-throughput screening platforms:

    • Systems for identifying compounds that modulate mechanosensitive channel function

    • Potential for discovering new classes of antimicrobials targeting bacterial osmoregulation

  • Synthetic biology tools:

    • Engineered mechanosensitive channels as cellular control elements

    • Integration into genetic circuits to create cells responsive to mechanical stimuli

    • Potential application in tissue engineering where mechanical forces regulate cell behavior

  • Fundamental research tools:

    • mscL as a model system for studying membrane protein folding and assembly

    • Platform for testing membrane protein expression and purification technologies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.