Recombinant Salmonella typhimurium Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid Transport

MsbA facilitates ATP-dependent lipid A translocation via a "trap and flip" mechanism:

  1. Lipid A Binding: Captures lipid A from the cytoplasmic leaflet.

  2. Conformational Change: ATP hydrolysis induces a structural shift, flipping lipid A to the periplasmic leaflet.

  3. Post-Transport Docking: Lipid A may temporarily bind to a periplasmic cleft before LPS assembly .

ATPase Activity and Substrate Binding

MsbA exhibits polyspecificity, interacting with lipid A, phospholipids, and amphipathic drugs . Key parameters include:

ParameterValue (MsbA-ST)Value (MsbA-EC)Source
ATPase Activity (V<sub>max</sub>)2.0 μmol/min/mg1.7 μmol/min/mg
K<sub>m</sub> (ATP)0.300 mM0.440 mM
Lipid A Affinity (K<sub>d</sub>)~57 μM~Low μM

Functional Assays

  • Proteoliposome Reconstitution: Purified MsbA reconstituted into E. coli lipid vesicles demonstrated ATP-dependent flippase activity for phospholipids (e.g., PE, PS) and glycolipids .

  • Drug Interactions: Overexpression of MsbA in Lactococcus lactis conferred resistance to erythromycin and other amphipathic compounds, reversed by vinblastine .

SubstrateAffinity (K<sub>m</sub> or K<sub>d</sub>)Source
Lipid A57 ± 15 μM
Ethidium3.1–4.8 μM
Vinblastine11–16 μM

Implications for Antibiotic Development

MsbA’s essential role and structural adaptability make it a prime target for novel antibiotics. Key insights include:

  • Target Vulnerability: Inhibition of MsbA disrupts LPS biogenesis, leading to bacterial lysis .

  • Polyspecificity: Broad substrate recognition enables efflux of diverse antimicrobial agents, contributing to multidrug resistance .

Recombinant Protein Applications

Recombinant MsbA (e.g., His-tagged variants) is utilized in structural and functional studies:

  • Production: Expressed in E. coli, purified via Ni-NTA chromatography, and validated for ATPase activity .

  • Applications:

    • X-ray crystallography for structural insights.

    • In vitro assays to study lipid translocation and drug interactions .

Recombinant MsbA FeatureSpecificationSource
Expression SystemE. coli
Purity>90% (SDS-PAGE)
ATPase ActivityCompetitive inhibition by AMPPNP

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
msbA; STM0984; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
msbA
Target Protein Sequence
MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTD RSVLLWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSI AIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVIDRATGDLEFRNVTFTYPGREVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEQADEIVVVEDGIIVERGTHSELLAQHGVYAQLHKMQFGQ
Uniprot No.

Target Background

Function
MsbA is involved in lipopolysaccharide (LPS) biosynthesis. It translocates the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides the energy for this process.
Gene References Into Functions
  1. MsbA, reconstituted in stable lipid bilayer nanodiscs at physiological temperatures, exhibits a conformation distinct from those observed in previous crystal structures or liposomes with/without detergent. PMID: 26725230
  2. This study analyzes the structural and functional roles of coupling helices in the ATP-binding cassette transporter MsbA using enzyme assays and molecular dynamics simulations. PMID: 24937232
  3. Atomistic simulations were used to analyze the conformational transition pathway of the ATP-binding cassette transporter MsbA. PMID: 19996093
  4. A comparison of four MsbA X-ray structures (two nucleotide-bound and two without nucleotide) reveals a flexible hinge formed by extracellular loops 2 and 3, enabling a wide range of motion. PMID: 18024585
Database Links

KEGG: stm:STM0984

STRING: 99287.STM0984

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MsbA and what is its functional significance in Gram-negative bacteria?

MsbA is an essential ATP-binding cassette (ABC) transporter in Gram-negative bacteria, including Salmonella typhimurium. Its primary function is to transport lipid A and lipopolysaccharide (LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . This translocation is a critical step in the biogenesis of the outer membrane of Gram-negative bacteria, which serves as a protective barrier against environmental stresses and antimicrobial agents. The essentiality of MsbA for bacterial viability makes it an attractive target for antimicrobial development.

The protein consists of 582 amino acids and functions as a homodimer. Each monomer contains a transmembrane domain (TMD) and a nucleotide-binding domain (NBD). The TMDs form the pathway through which lipid A passes, while the NBDs bind and hydrolyze ATP to power the transport process .

What structural features characterize the MsbA transporter?

The X-ray crystal structure of MsbA from Salmonella typhimurium has been resolved at 2.8 Å resolution (PDB entry: 6o30) in an inward-facing conformation after co-crystallization with lipid A . The structure reveals several key features:

  • A homodimeric arrangement with each monomer containing six transmembrane helices and a nucleotide-binding domain.

  • A large amplitude opening in the transmembrane portal, which is likely required for lipid A to pass from its site of synthesis into the protein-enclosed transport pathway .

  • Putative lipid A density observed inside the transmembrane cavity, consistent with a "trap and flip" model of transport .

  • Additional electron density attributed to lipid A observed near an outer surface cleft at the periplasmic ends of the transmembrane helices .

The inward-facing conformation represents the initial stage of the transport cycle, where the transporter is open to the cytoplasm to receive its substrate (lipid A). The structure provides crucial insights into how this large, amphipathic molecule enters and traverses the transporter.

How can I distinguish between different conformational states of MsbA?

MsbA undergoes substantial conformational changes during its transport cycle. These different states can be distinguished through several methods:

  • X-ray crystallography: Various conformations have been captured by crystallization under different conditions. The inward-facing conformation (as seen in PDB 6o30) has a large opening toward the cytoplasmic side, while outward-facing conformations show opening toward the periplasmic space .

  • Biochemical assays: Different conformations can be stabilized using nucleotides (ATP, ADP) or non-hydrolyzable ATP analogs.

  • Crosslinking studies: Chemical crosslinking at specific residues can trap the protein in particular conformations.

  • EPR spectroscopy: Site-directed spin labeling combined with EPR can monitor distances between specific residues in different conformational states.

The transmembrane helices undergo significant rearrangements during the transport cycle, which can be measured and quantified through these techniques.

What expression systems are optimal for recombinant Salmonella typhimurium MsbA?

Recombinant Salmonella typhimurium MsbA can be successfully expressed in several systems, with E. coli being the most commonly used host . Based on available data, the following expression systems and conditions have proven effective:

Table 1: Expression Systems for Recombinant MsbA Production

Expression SystemVectorTagsInduction ConditionsYieldNotes
E. coli BL21(DE3)pET-basedN-terminal His-tagIPTG, 18°C, 16-20 hours1-3 mg/LLow temperature improves proper folding
E. coli C43(DE3)pET-basedHis-tagIPTG, 20°C, overnight2-5 mg/LStrain engineered for membrane proteins
E. coli Lemo21(DE3)pET-basedHis-tagIPTG + rhamnose, 25°C1-4 mg/LTunable expression level

The expression of full-length MsbA (amino acids 1-582) with an N-terminal His-tag in E. coli has been documented to produce functional protein . Lower expression temperatures (18-25°C) are generally recommended to improve proper folding of membrane proteins and reduce formation of inclusion bodies.

What are the most effective purification strategies for obtaining high-purity MsbA?

Purification of MsbA requires careful handling of detergents throughout the process to maintain protein stability and activity. A recommended purification protocol includes:

  • Membrane isolation: Harvest cells and lyse using mechanical methods (French press or sonication). Collect membrane fraction by ultracentrifugation.

  • Solubilization: Solubilize membranes using appropriate detergents. Common detergents include n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or facial amphiphiles which have been shown to stabilize MsbA .

  • Affinity chromatography: If using His-tagged protein, purify using Ni-NTA or TALON resin in the presence of detergent .

  • Size exclusion chromatography: Further purify by size exclusion chromatography to separate aggregates and obtain homogeneous protein.

The use of stabilizing facial amphiphiles has been particularly effective in structural studies of MsbA, as they help maintain the protein in a native-like conformation suitable for crystallization .

How can I assess the functional activity of purified recombinant MsbA?

Several assays can be used to verify that purified recombinant MsbA retains its functional activity:

  • ATPase activity assay: Measure ATP hydrolysis using colorimetric assays (malachite green) or coupled enzyme assays. Basal ATPase activity should be stimulated in the presence of lipid A or transported substrates.

  • Lipid flippase assay: Reconstitute MsbA into liposomes with fluorescently labeled lipid analogs and measure translocation activity.

  • Substrate binding assays: Use surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure binding of lipid A to purified MsbA.

  • Conformational changes: Monitor nucleotide-induced conformational changes using limited proteolysis, tryptophan fluorescence, or EPR spectroscopy.

A functionally active preparation should show ATP hydrolysis activity that is enhanced in the presence of lipid substrates, demonstrating coupling between substrate binding and ATPase activity.

What crystallization conditions have been successful for obtaining MsbA structures?

The successful crystallization of Salmonella typhimurium MsbA with lipid A was achieved under specific conditions:

Table 2: Crystallization Conditions for Salmonella typhimurium MsbA

ParameterCondition
Protein concentration8-10 mg/mL
DetergentFacial amphiphile (stabilizing agent)
Co-crystallizationWith lipid A
Crystallization methodVapor diffusion (hanging or sitting drop)
PrecipitantPEG 400 (30-35%)
Buffer100 mM Tris-HCl, pH 8.0
Salt100-200 mM sodium/potassium salt
Temperature20°C
Crystal appearance time1-2 weeks

The use of facial amphiphiles as stabilizing agents was crucial for obtaining well-diffracting crystals of MsbA in complex with lipid A . These amphiphiles help stabilize the inward-facing conformation of the protein, facilitating crystal formation. For successful crystallization, it's important to maintain high protein purity (>95% by SDS-PAGE) and to screen multiple crystallization conditions systematically.

How do I interpret electron density maps for lipid A binding in MsbA structures?

Interpreting electron density maps for lipid A binding in MsbA structures can be challenging due to the flexible nature of lipid molecules and potential partial occupancy. Based on the reported structure (PDB: 6o30), the following approach is recommended:

  • Identify potential binding sites: In the Salmonella typhimurium MsbA structure, putative lipid A density was observed in three locations: within the transmembrane portal, inside the transmembrane cavity, and near an outer surface cleft at the periplasmic ends of the transmembrane helices .

  • Validate density features: Look for continuous density that matches the shape and size of lipid A. The acyl chains typically show clear, elongated density, while the phosphate groups may appear as discrete, spherical densities.

  • Build the model iteratively: Start by placing the rigid sugar-phosphate backbone, then add acyl chains, refining the position after each addition.

  • Assess model quality: Use real-space correlation coefficients, B-factors, and Ramachandran statistics to evaluate the quality of the fit.

The lipid A density observed in the Salmonella typhimurium MsbA structure supports a "trap and flip" model, where lipid A enters the transmembrane portal, is trapped within the cavity, and is flipped to the periplasmic leaflet during the transport cycle .

What computational approaches are useful for studying MsbA function?

Several computational approaches have proven valuable for studying MsbA function:

  • Molecular dynamics (MD) simulations: Allow for modeling of MsbA dynamics in a lipid bilayer environment, providing insights into conformational changes during the transport cycle. Simulations have been particularly useful in understanding how lipid A interacts with the transmembrane domain.

  • Homology modeling: For studying MsbA variants or homologs from different bacterial species, using the available structures (such as PDB 6o30) as templates.

  • Docking studies: To predict binding modes of potential inhibitors or substrate analogs.

  • Normal mode analysis: To identify large-scale collective motions that may be important for the transport mechanism.

  • Sequence conservation analysis: To identify functionally important residues that are conserved across bacterial species.

These computational approaches, when integrated with experimental data, provide a more complete understanding of the structural basis of MsbA function and can guide experimental design.

How does the mechanism of lipid A transport by MsbA compare to other ABC transporters?

MsbA's mechanism of lipid A transport exhibits both similarities and differences compared to other ABC transporters:

Similarities to other ABC transporters:

  • ATP binding and hydrolysis at the NBDs drive conformational changes in the TMDs.

  • Alternating access mechanism involving inward-facing, occluded, and outward-facing states.

  • Dimerization of NBDs upon ATP binding, leading to conformational changes transmitted to the TMDs.

Unique features of MsbA:

  • The substrate (lipid A) is unusually large and amphipathic, requiring a large portal opening in the inward-facing conformation .

  • MsbA must extract lipid A from the inner leaflet of the membrane, rather than binding a soluble substrate.

  • The structure reveals a "trap and flip" mechanism, where lipid A is captured within the transmembrane cavity before being flipped to the periplasmic leaflet .

  • Unlike many ABC exporters, MsbA must maintain the amphipathic nature of its substrate throughout transport, keeping the hydrophilic portion separate from the hydrophobic region.

These unique features adapt MsbA specifically for its role in lipid A transport, distinguishing it from ABC transporters that handle smaller, more hydrophilic substrates.

How do mutations in MsbA affect lipid A transport and bacterial virulence?

Mutations in MsbA can significantly impact lipid A transport and, consequently, bacterial virulence through several mechanisms:

  • Transport efficiency: Mutations in the transmembrane domain can affect the binding and transport of lipid A, leading to accumulation of lipid A in the cytoplasmic leaflet and disruption of outer membrane biogenesis.

  • ATPase activity: Mutations in the NBDs can alter ATP binding or hydrolysis, affecting the energy coupling necessary for transport.

  • Conformational flexibility: Mutations that restrict conformational changes can lock MsbA in specific states, preventing completion of the transport cycle.

  • Substrate specificity: Some mutations may alter the substrate specificity of MsbA, affecting the types of lipid A molecules that can be transported.

The consequences of these mutations include:

  • Decreased viability under stress conditions

  • Increased sensitivity to antibiotics due to compromised outer membrane integrity

  • Altered LPS structure on the bacterial surface, affecting host immune recognition

  • Reduced virulence in infection models

Studying these mutations provides insights into MsbA function and identifies potential sites for therapeutic targeting.

What techniques are emerging for studying MsbA dynamics and transport mechanism?

Several cutting-edge techniques are advancing our understanding of MsbA dynamics and transport mechanism:

  • Cryo-electron microscopy (cryo-EM): Allows visualization of MsbA in different conformational states without the need for crystallization, potentially capturing transient intermediates in the transport cycle.

  • Single-molecule FRET (smFRET): Enables real-time monitoring of conformational changes in individual MsbA molecules during transport.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information about protein dynamics and solvent accessibility changes during the transport cycle.

  • Native mass spectrometry: Allows study of lipid A binding to MsbA in a near-native environment.

  • Time-resolved crystallography: Using X-ray free-electron lasers (XFELs) to capture short-lived conformational states during transport.

  • Nanodiscs and lipid cubic phase (LCP) technologies: Enable study of MsbA function in more native-like membrane environments.

These emerging techniques complement traditional structural and biochemical approaches, providing a more complete picture of the dynamic processes involved in lipid A transport by MsbA.

Why might my recombinant MsbA show low expression levels or poor solubility?

Low expression levels or poor solubility of recombinant MsbA can result from several factors:

Table 3: Troubleshooting MsbA Expression and Solubility Issues

IssuePossible CausesRecommended Solutions
Low expressionToxicity to host cellsUse C43(DE3) or Lemo21(DE3) strains designed for membrane proteins
Inefficient translationOptimize codon usage for expression host
Protein degradationAdd protease inhibitors; reduce expression temperature to 18-20°C
Poor solubilityInadequate detergentTest different detergents (DDM, LMNG, facial amphiphiles)
Improper foldingExpress at lower temperatures; add chemical chaperones
AggregationInclude glycerol (5-10%) in buffer; avoid freeze-thaw cycles
Tag interferenceTry different tag positions or remove tag after purification

The use of specialized E. coli strains designed for membrane protein expression and the careful selection of detergents are particularly important for successful MsbA production. Facial amphiphiles have been effectively used to stabilize MsbA in structural studies and may improve solubility during purification .

What controls should I include in MsbA functional assays?

Robust controls are essential for validating MsbA functional assays:

For ATPase activity assays:

  • Negative control: Heat-inactivated MsbA or ATPase-deficient mutant (e.g., Walker A lysine mutation)

  • Positive control: Known ATPase like F1-ATPase with established activity

  • Background control: Reaction mixture without MsbA to account for non-enzymatic ATP hydrolysis

  • Inhibitor control: Vanadate or other ATPase inhibitors to confirm specificity

  • Substrate stimulation: Compare ATPase activity with and without lipid A or LPS

For lipid flippase assays:

  • Passive diffusion control: Liposomes without MsbA to measure background flipping

  • Nucleotide dependence: Compare activity with ATP, non-hydrolyzable ATP analogs, and without nucleotides

  • Detergent control: Detergent at concentrations that disrupt liposomes (positive control for complete accessibility)

  • Temperature control: Reduced temperature should slow enzymatic activity but not passive diffusion

For binding assays:

  • Nonspecific binding control: MsbA-free surface or beads to measure background binding

  • Competition control: Unlabeled lipid A to compete with labeled substrate

  • Negative control: Unrelated lipid that should not bind specifically to MsbA

Including these controls ensures that the observed activity is specific to MsbA and allows for proper interpretation of results.

How can I overcome challenges in crystallizing MsbA with bound substrates or inhibitors?

Crystallizing MsbA with bound substrates or inhibitors presents specific challenges that can be addressed through several strategies:

  • Stabilize specific conformations: Use ATP analogs (AMP-PNP, ATPγS) or vanadate-trapped states to stabilize specific conformations that may favor crystal formation.

  • Engineer crystallization constructs: Introduce mutations that reduce conformational flexibility or remove disordered regions while maintaining function.

  • Co-purification with substrates: Purify MsbA in the presence of lipid A or the substrate/inhibitor of interest to maintain the complex throughout purification.

  • Facial amphiphiles: These have been successfully used to stabilize MsbA for crystallization and may help maintain substrate binding .

  • Lipidic cubic phase (LCP) crystallization: This method provides a more native-like membrane environment that may better support substrate binding.

  • Nanobodies or crystallization chaperones: These can stabilize specific conformations and provide additional crystal contacts.

  • Screening multiple substrate analogs: Test substrate or inhibitor analogs with varying properties (solubility, affinity) to identify those that promote crystallization.

The successful crystallization of Salmonella typhimurium MsbA with lipid A utilized co-crystallization with the substrate and stabilization with facial amphiphiles, demonstrating the effectiveness of these approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.