Recombinant Salmonella typhimurium Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Overview of LspA and Its Biological Role

Lipoprotein signal peptidase (LspA) is a type II signal peptidase (SPase II) critical for processing bacterial lipoproteins. In Salmonella Typhimurium, LspA cleaves the signal peptide from prolipoproteins, enabling their maturation and subsequent localization to the outer membrane. This enzyme is essential for bacterial viability, as lipoproteins are integral to membrane integrity, nutrient uptake, and virulence .

Transcriptional Regulation During Infection

Real-time qRT-PCR studies in related pathogens (e.g., R. typhi) demonstrate that lspA transcription peaks during early infection (preinfection and 48 h postinfection) and declines during host cell lysis . Co-expression with lgt (prolipoprotein transferase) and lepB (SPase I) suggests coordinated regulation of lipoprotein and non-lipoprotein secretion pathways .

Immunological Implications

Although S. Typhimurium lspA itself is not a vaccine target, its role in lipoprotein maturation indirectly impacts vaccine design:

  • Lipoprotein Knockouts: Deletion of lpp (Braun lipoprotein) in S. Typhimurium attenuates virulence and enhances immune responses to recombinant antigens (e.g., PspA, InvH) .

  • Adjuvant Effects: Mature lipoproteins activate Toll-like receptor 2 (TLR2), synergizing with LPS (TLR4) to amplify proinflammatory cytokine production .

Key Research Findings

  • Lipoprotein Processing: S. Typhimurium requires LspA to process ~14 lipoproteins predicted from genomic analysis, versus 89 secretory proteins processed by SPase I (LepB) .

  • Antibiotic Sensitivity: Globomycin inhibits LspA, causing accumulation of unprocessed prolipoproteins and bacterial growth arrest .

  • Recombinant Antigen Delivery: Attenuated Salmonella strains expressing heterologous antigens (e.g., PspA, InvH) leverage Sec or T3SS pathways for antigen secretion, bypassing LspA-dependent lipoprotein processing .

Challenges and Future Directions

  • Enzyme Specificity: Low sequence conservation complicates cross-species complementation studies .

  • Therapeutic Targeting: SPase II inhibitors like globomycin are potential antimicrobials but require optimization for Salmonella-specific delivery .

  • Vaccine Engineering: Regulated delayed lysis Salmonella strains (e.g., χ11802) enhance antigen release and mucosal immunity without relying on lipoprotein processing .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; STM0047; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
lspA
Target Protein Sequence
MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGNWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: stm:STM0047

STRING: 99287.STM0047

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.