Recombinant Salmonella typhimurium Magnesium transport protein CorA (corA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
corA; STM3952; STMD1.38; Magnesium transport protein CorA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
corA
Target Protein Sequence
MLSAFQLEKNRLTRLEVEESQSLIDAVWVDLVEPDDDERLRVQSELGQSLATRPELEDIE ASARFFEDEDGLHIHSFFFFEDAEDHAGNSTVAFTIRDGRLFTLRERELPAFRLYRMRAR SQAMVDGNAYELLLDLFETKIEQLADEIENIYSDLEKLSRVIMEGHQGDEYDEALSTLAE LEDIGWKVRLCLMDTQRALNFLVRKARLPGGQLEQAREILRDIESLLPHNESLFQKVNFL MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGAIIFMI LAGLAPYLYFKRKNWL
Uniprot No.

Target Background

Function
This protein mediates both the influx and efflux of magnesium ions. It can also transport cobalt and nickel, but only at extracellular concentrations toxic to the cell. It does not transport iron. The protein functions through an alternating open and closed state mechanism, activated by low cytoplasmic Mg2+ levels and inactivated by high cytoplasmic Mg2+ levels.
Gene References Into Functions
  1. Overexpression of the Mg2+ transporter CorA, presumed to increase cytoplasmic Mg2+ levels, decreased mgtA transcription in a manner dependent on a functional mgtA 5' leader. PMID: 19897653
  2. CorA does not transport Fe2+; any relationship between iron toxicity and corA is indirect. PMID: 15516579
  3. CorA affects lactoperoxidase sensitivity but not other oxidative stress responses. PMID: 16269676
  4. A corA mutant exhibits attenuated virulence in mice and impaired invasion and replication within epithelial cells. PMID: 18676664
  5. Loss of the CorA protein disrupts regulatory networks, resulting in decreased virulence. PMID: 18676666
Database Links

KEGG: stm:STM3952

STRING: 99287.STM3952

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CorA protein in Salmonella typhimurium?

CorA is a pentameric membrane protein that serves as the primary magnesium (Mg²⁺) transporter in Salmonella typhimurium. It belongs to the 2-TM-GxN family of membrane proteins that play a major role in Mg²⁺ transport across prokaryotic membranes and eukaryotic mitochondria. The protein contains a large cytoplasmic domain with regulatory functions and a transmembrane component consisting of two α-helices per protomer arranged as inner and outer pentamers. The signature motif GxN in the connecting loops is believed to be involved in substrate selection . CorA is essential for bacterial survival under various stress conditions and contributes significantly to the virulence and pathogenicity of Salmonella.

How does the structure of CorA relate to its function?

CorA forms a homopentameric channel with each subunit containing two transmembrane helices. The protein exists in a dynamic equilibrium between multiple conformational states, which is regulated by Mg²⁺ binding. When Mg²⁺ is bound, CorA predominantly adopts non-conducting states, while in Mg²⁺-free conditions, conducting states become more populated . Recent structural studies using small-angle neutron scattering (SANS) combined with molecular dynamics simulations have shown that CorA's functional regulation involves complex conformational dynamics beyond simple "open" and "closed" states. The protein samples both symmetric and asymmetric conformations regardless of Mg²⁺ binding, but the distribution between these states shifts depending on Mg²⁺ concentration . This dynamic behavior is essential for understanding how CorA regulates magnesium homeostasis in bacteria.

What experimental approaches are most effective for studying CorA in Salmonella?

Multiple complementary approaches have proven effective for studying CorA:

  • Genetic manipulation: Creating knockout mutants (ΔcorA) has been instrumental in understanding CorA's physiological roles. These mutants have demonstrated hypersensitivity to various stressors, including lactoperoxidase systems and desiccation .

  • Structural biology: Combining techniques like X-ray crystallography with dynamic methods such as SANS and solid-state NMR spectroscopy has revealed the conformational equilibria of CorA .

  • Fluorescence-based transport assays: Reconstituting purified CorA into proteoliposomes allows direct measurement of ion transport activities across different conditions .

  • Complementation studies: Introducing cloned corA genes into mutant strains can confirm phenotype specificity and functional rescue, as demonstrated in both E. coli and Salmonella enterica serovar Typhimurium .

What range of cations can be transported by Salmonella CorA?

CorA demonstrates broader ion selectivity than originally thought. Fluorescence-based transport assays with reconstituted CorA proteins have established that:

CationTransport by CorANotes
Mg²⁺Yes - Primary substrateHighest physiological relevance
Co²⁺YesReadily transported
Ni²⁺YesReadily transported, can sensitize cells when pre-exposed
Zn²⁺YesReadily transported
Al³⁺NoNot transported

This cation permeability profile is conserved across CorA homologs from different species, including Thermotoga maritima and Methanocaldococcus jannaschii . The ability to transport multiple divalent cations has important implications for metal homeostasis beyond just magnesium regulation.

How is CorA transport activity regulated at the molecular level?

CorA transport activity is regulated through a complex interplay of factors:

  • Conformational dynamics: CorA exists in equilibrium between multiple states, with the distribution shifting based on Mg²⁺ availability. In high Mg²⁺ conditions, non-conducting states predominate, while conducting states become more frequent in low Mg²⁺ environments .

  • Membrane potential: Unlike its related family member ZntB, CorA transport is primarily stimulated by membrane potential rather than proton gradients . This fundamental difference demonstrates functional divergence within the 2-TM-GxN family.

  • Mg²⁺ sensing: The large cytoplasmic domains function as sensors for intracellular Mg²⁺ concentration, with multiple binding sites that induce conformational changes when occupied .

  • Backbone dynamics: NMR studies have revealed variations in backbone dynamics with and without Mg²⁺, suggesting that protein flexibility plays a crucial role in channel gating and ion selectivity .

How does CorA contribute to stress tolerance in Salmonella?

CorA plays a significant role in Salmonella's ability to withstand various environmental stresses:

  • Antimicrobial system tolerance: The deletion of corA causes hypersensitivity to the lactoperoxidase system, a natural antimicrobial defense mechanism. This hypersensitivity is specific to the lactoperoxidase system and doesn't extend to hydrogen peroxide or superoxide generators like plumbagin .

  • Desiccation resistance: Global screening of Salmonella enterica serovar Typhimurium has identified corA as one of only three genes (along with atpH and atpG) whose deletion significantly reduces bacterial survival under desiccation conditions (p < 0.02) . This suggests an important role for magnesium homeostasis in withstanding dehydration stress.

  • Metal toxicity protection: By mediating the influx of essential Mg²⁺ and efflux of potentially toxic metals like Ni²⁺, CorA helps maintain ion homeostasis under varying environmental conditions. Prior exposure to 0.3 mM Ni²⁺, which is also transported by CorA, strongly sensitizes wild-type Salmonella but not corA mutants to certain stressors .

What is the relationship between CorA function and bacterial virulence?

The connection between CorA and Salmonella virulence involves several aspects:

  • Stress adaptation: Since host environments subject bacteria to various stresses, CorA's role in stress tolerance directly impacts pathogenicity and persistence during infection.

  • Immune evasion: The lactoperoxidase system represents an important host defense mechanism, and CorA's contribution to resistance against this system may enhance Salmonella's ability to colonize host tissues .

  • Vaccine development implications: Research on recombinant attenuated Salmonella Typhimurium vaccines has shown that understanding ion transport systems like CorA is crucial for rational vaccine design . The ability to manipulate these systems can influence immunogenicity and protective efficacy.

How can researchers effectively generate and validate CorA mutants?

Creating and validating CorA mutants requires a systematic approach:

  • Knockout construction:

    • Use targeted gene deletion approaches such as λ-Red recombination system to create precise deletions of the corA gene.

    • For global screening approaches, Tn5 transposon mutagenesis libraries have been successfully employed to identify the role of corA in stress responses .

  • Phenotypic validation:

    • Compare survival rates of wild-type and mutant strains under specific stress conditions (e.g., desiccation, antimicrobial challenges).

    • For the lactoperoxidase system challenge, the glucose oxidase/glucose system with KSCN provides an appropriate control treatment .

  • Complementation:

    • Express wild-type corA from a plasmid in the deletion strain to confirm phenotype specificity.

    • Studies have shown that complementation with an intact corA gene restores resistance to wild-type levels or even slightly higher in both E. coli and Salmonella enterica .

  • Quantification methods:

    • Calculate survival percentages by comparing CFU/ml before and after stress exposure.

    • Statistical validation using unpaired t-tests can determine significant differences between wild-type and mutant strains .

What assays are most suitable for studying CorA transport activity?

Several established assays provide insights into CorA transport function:

  • Fluorescence-based transport assays:

    • Reconstitute purified CorA into proteoliposomes with fluorescent indicators sensitive to specific ions.

    • This approach has successfully demonstrated transport of multiple divalent cations (Mg²⁺, Co²⁺, Ni²⁺, Zn²⁺) through CorA .

  • Membrane potential manipulation:

    • Since CorA transport is stimulated by membrane potential rather than proton gradients (unlike ZntB), assays that manipulate membrane potential are particularly informative .

    • Use ionophores or varying ionic conditions to alter membrane potential while monitoring ion transport.

  • In vivo metal sensitivity tests:

    • Expose bacteria to varying concentrations of different metal ions and measure growth inhibition.

    • Pre-exposure to Ni²⁺ (0.3 mM) has been shown to sensitize wild-type but not corA mutant strains .

  • Structural dynamics assays:

    • Small-angle neutron scattering (SANS) combined with molecular dynamics simulations provides insights into conformational equilibria.

    • Solid-state NMR spectroscopy can reveal backbone dynamics variations with and without Mg²⁺ .

How do conformational dynamics influence CorA function?

Recent research has revealed sophisticated dynamics underlying CorA function:

How can researchers address contradictions in experimental data regarding CorA function?

Contradictory findings are common in complex biological systems. For CorA research, several approaches can help resolve discrepancies:

How can CorA research inform vaccine development strategies?

CorA research has several implications for vaccine development:

  • Attenuation strategies: Understanding ion transport systems like CorA can inform rational approaches to bacterial attenuation for vaccine development. Since corA mutations affect stress responses and survival, they might be incorporated into vaccine strain design .

  • Immunogenicity considerations: Studies on recombinant attenuated Salmonella Typhimurium vaccines have shown that manipulation of bacterial physiology affects immune response development. Research has demonstrated that specific vaccine strains can induce significant serum IgG responses against Salmonella Typhimurium LPS .

  • Protection mechanisms: Knowledge of how CorA contributes to Salmonella survival in host environments can help predict vaccine efficacy and design challenge models. Understanding bactericidal antibody induction by vaccine strains is particularly relevant .

What emerging technologies might advance CorA research?

Several cutting-edge approaches show promise for deepening our understanding of CorA:

  • Cryo-electron microscopy: High-resolution cryo-EM could reveal additional conformational states of CorA that have not been captured by crystallography, particularly transient intermediates in the transport cycle.

  • Advanced simulation methods: Enhanced sampling molecular dynamics simulations can help characterize the free energy landscape of CorA conformational states and transitions between them, building on current understanding of conformational equilibria .

  • Single-molecule techniques: Methods like single-molecule FRET could directly observe conformational dynamics of individual CorA channels in real-time, providing insights into the heterogeneity of states and transition kinetics.

  • In situ structural biology: Techniques for studying protein structure and dynamics within intact bacterial cells would provide more physiologically relevant information about CorA function than reconstituted systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.