Recombinant Salmonella typhimurium Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella typhimurium Membrane Protein Insertase YidC

YidC is an essential bacterial membrane protein insertase responsible for the co-translational integration and folding of membrane proteins. In Salmonella typhimurium, YidC facilitates the insertion of substrate proteins into the cytoplasmic membrane, either independently or in concert with the Sec translocon . Recombinant YidC refers to the protein expressed heterologously in systems such as Escherichia coli, yeast, or mammalian cells for research and biotechnological applications . Its structural and functional conservation across bacteria makes it a critical target for studying membrane protein biogenesis and antibiotic development .

Functional Mechanism

YidC operates via two pathways:

  1. Sec-Independent Insertion:

    • Binds substrates like Pf3 coat protein within 2 ms via its cytoplasmic hairpin .

    • Strengthens substrate interaction within 52 ms, facilitating insertion at the protein-lipid interface .

    • Requires a hydrophilic microenvironment to translocate polar termini of substrates .

  2. Sec-Dependent Collaboration:

    • Assists SecYEG in lateral clearance of transmembrane domains during co-translational insertion .

    • Acts as a chaperone for respiratory complexes (e.g., ATP synthase) .

Key functional residues include Arg366 (critical for substrate binding) and hydrophilic residues in the TM groove .

Vaccine Development

Recombinant YidC from Salmonella gallinarum (strain 287/91) is used as an antigen in vaccine research due to its surface exposure and role in pathogenicity .

Antibiotic Targeting

YidC depletion in E. coli causes severe growth defects, underscoring its viability as a drug target . Antisense RNA targeting yidC reduces bacterial survival by disrupting membrane protein assembly .

Research Findings

  • Substrate Specificity: YidC preferentially inserts proteins with short translocated domains (e.g., MscL, TssL) .

  • Role in Virulence: Salmonella YidC indirectly regulates SPI-2 virulence factors by maintaining outer membrane stability .

  • Chaperone Activity: Accelerates folding of polytopic proteins (e.g., MelB permease) by preventing misfolding .

Production and Purification

Recombinant YidC is produced in multiple expression systems:

Expression HostPurityApplication
E. coli>95%Structural studies
Baculovirus/Insect cells>90%Functional assays

Purification typically involves affinity chromatography and size-exclusion chromatography .

Challenges and Future Directions

  • Mechanistic Details: The exact sequence of substrate transfer from YidC to the membrane remains unresolved .

  • Structural Dynamics: Real-time visualization of YidC-substrate interactions requires advanced cryo-ET techniques .

  • Therapeutic Potential: Engineering YidC inhibitors could combat multidrug-resistant Salmonella infections .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; STM3842; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
yidC
Target Protein Sequence
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQTQQTTQTTTTAAGSAADQGVPASGQGKM ITVKTDVLDLTINTRGGDVEQALLPAYPKELGSNEPFQLLETTPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKEAFVLADGQNELQVPMTYTDAAGNTFTKTFVFKRGDYAVNVNYSV QNAGEKPLEVSTFGQLKQSVNLPPHRDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNVSSKGGWVAMLQQYFATAWIPRNDGTNNFYTANLGNGIVAIGYKAQPVLVQPGQT GAMTSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRQSQEMMALYKAEKVNPL GGCFPLIIQMPIFLALYYMLMGSIELRHAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and/or complex formation of integral membrane proteins within the membrane. Involved in integrating membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as certain lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links

KEGG: stm:STM3842

STRING: 99287.STM3842

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its fundamental function in bacterial cells?

YidC is an essential membrane protein insertase found in bacteria that facilitates the insertion and proper folding of a variety of integral membrane proteins into the cytoplasmic membrane. Unlike the Sec translocase system that forms a complete channel across the membrane, YidC creates a hydrophilic groove that partially penetrates the membrane from the cytosolic side . This structure helps reduce the energy barrier for inserting membrane proteins by providing a hydrophilic environment for polar protein segments while simultaneously allowing hydrophobic segments to interact with the membrane lipids.

In Salmonella typhimurium, as in other bacteria, YidC plays a vital role in maintaining membrane proteome homeostasis. It is particularly critical for the biogenesis of proteins involved in energy metabolism, including components of respiratory complexes . YidC operates either independently or in conjunction with the SecYEG translocon to facilitate the insertion of various membrane proteins with different topologies and complexities.

The essential nature of YidC has been demonstrated through depletion studies, which show that reducing YidC levels results in impaired bacterial growth and eventual cell death . This confirms its indispensable role in bacterial physiology and explains why YidC homologs are found in virtually all bacterial species, reflecting its ancient evolutionary origin and fundamental importance.

How is YidC structurally organized and how does this structure relate to its function?

YidC possesses a conserved core structure consisting of five transmembrane helices (TM1-TM5) that form a distinctive hydrophilic groove within the membrane. This groove is open to the cytoplasm and extends partially into the membrane bilayer, creating a protective environment for polar residues of substrate proteins during their insertion . Additionally, YidC contains a cytoplasmic α-helical hairpin domain that plays a crucial role in substrate recognition and initial binding.

Structural analysis has revealed a striking similarity between YidC and the SecY component of the Sec translocase, suggesting a unified evolutionary origin for these two protein insertion systems . Both proteins share a hairpin-interrupted three-transmembrane helix motif, although YidC's hydrophilic groove only forms a "half-channel" compared to the complete channel formed by SecY. This structural homology indicates that YidC may represent an ancestral form of membrane protein insertase from which more complex systems evolved.

The partial penetration of YidC's hydrophilic groove into the membrane creates local membrane thinning and distortion, which has been confirmed by molecular dynamics simulations . This membrane deformation reduces the energetic barrier for translocation of polar segments of substrate proteins across the hydrophobic core of the membrane. Unlike SecY, which requires ATP hydrolysis to drive protein translocation, YidC harnesses the favorable energetics of partitioning hydrophobic segments into the membrane while shielding polar residues from the hydrophobic environment.

What experimental approaches are used to study YidC function?

Multiple experimental systems have been developed to investigate YidC function, each offering unique advantages for addressing specific research questions:

Genetic Depletion and Silencing Systems: Researchers employ conditional expression systems or antisense RNA strategies to study the consequences of YidC depletion on bacterial growth and membrane proteome composition . These approaches have demonstrated that reducing YidC expression results in growth retardation and significant alterations in membrane protein integration, confirming its essential role in bacterial viability.

In vitro Translation/Insertion Assays: These systems utilize inverted membrane vesicles (INVs) prepared from bacterial cells expressing different levels of YidC . By comparing insertion efficiency of model substrates like Pf3 coat protein, M13 procoat, and F0c into these vesicles, researchers can directly assess the impact of YidC concentration on insertion activity. Recent studies have shown that vesicles enriched with YibN, a YidC interactor, can stimulate insertion 1.5-1.8 fold for various substrate proteins, suggesting complex regulatory mechanisms .

Single-Molecule Biophysical Techniques: Advanced approaches combining single-molecule force spectroscopy and fluorescence spectroscopy allow researchers to monitor the binding and insertion of individual substrate proteins by YidC in real-time . These studies have revealed that substrate binding occurs within approximately 2 milliseconds, while complete insertion takes about 52 milliseconds, providing unprecedented temporal resolution of the insertion process.

Structural Studies: X-ray crystallography and cryo-electron microscopy have been employed to determine the three-dimensional structure of YidC, providing crucial insights into the arrangement of its transmembrane domains and the formation of the hydrophilic groove essential for its function . These structural data have been instrumental in developing mechanistic models of YidC-mediated insertion.

Proteomic Analysis: Mass spectrometry-based proteomics approaches identify proteins that show reduced membrane integration following YidC depletion, helping to define the YidC-dependent proteome and understand its substrate specificity . These studies have revealed that YidC is particularly important for integrating proteins with specific topological features.

How conserved is YidC across different bacterial species?

YidC represents one of the most highly conserved membrane protein families across bacterial domains, reflecting its fundamental role in cellular physiology. This conservation extends beyond bacteria, with homologs found in mitochondria (Oxa1), chloroplasts (Alb3), and the eukaryotic endoplasmic reticulum (GET1), suggesting an ancient evolutionary origin predating the divergence of these organelles from bacterial ancestors .

Within bacterial species, YidC shows significant sequence and structural conservation, particularly in the transmembrane domains and functional motifs essential for insertase activity. The core five-transmembrane helix structure and the hydrophilic groove are preserved across diverse bacterial phyla, though some variability exists in the cytoplasmic and periplasmic domains .

What strategies are used for recombinant expression and purification of YidC?

Recombinant expression and purification of YidC present significant challenges due to its nature as an integral membrane protein with multiple transmembrane domains. Researchers have developed several strategies to overcome these challenges:

Expression Systems: Escherichia coli is the most commonly used host for recombinant YidC expression, with specialized strains like C41(DE3) or C43(DE3) that are optimized for membrane protein production . Alternative expression hosts include yeast (Saccharomyces cerevisiae or Pichia pastoris), baculovirus-infected insect cells, or mammalian cell lines, which may provide advantages for proper folding and post-translational modifications . The choice of expression system depends on the specific requirements of the study and the properties of the YidC protein being expressed.

Vector Design: Expression constructs typically incorporate affinity tags (His6, FLAG, or Strep-tag) at either the N- or C-terminus to facilitate purification, while avoiding disruption of membrane-spanning regions that are critical for function . The placement of these tags requires careful consideration of the protein's topology to ensure they do not interfere with membrane insertion or substrate binding.

Expression Conditions: Optimal expression typically requires lower temperatures (18-25°C) and longer induction periods (10-24 hours) to promote proper membrane integration and reduce the formation of inclusion bodies . Inducer concentration and cell density at induction are also critical parameters that need optimization for each expression system.

Membrane Extraction: Following cell lysis, membranes containing YidC are isolated through differential centrifugation and then solubilized using appropriate detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin at optimized concentrations . The choice of detergent is crucial as it must efficiently extract YidC from the membrane while preserving its native structure and function.

Purification Protocol: Purification typically involves multiple chromatography steps, starting with affinity chromatography (using Ni-NTA for His-tagged proteins), followed by size exclusion chromatography to separate different oligomeric states and remove aggregates . Additional ion exchange or hydrophobic interaction chromatography steps may be included depending on the required purity.

Functional Reconstitution: For functional studies, purified YidC is often reconstituted into proteoliposomes or nanodiscs that mimic the native membrane environment, allowing for assessment of its insertase activity in a defined system . These reconstituted systems are valuable for investigating the mechanistic details of YidC-mediated insertion without the complexities of the cellular environment.

What is the molecular mechanism by which YidC facilitates membrane protein insertion?

YidC facilitates membrane protein insertion through a sophisticated mechanism that involves specific interactions with substrate proteins and coordinated structural changes. Recent studies combining single-molecule techniques and molecular dynamics simulations have revealed a multistep process:

Initial Substrate Capture (0-2 ms): The cytoplasmic α-helical hairpin domain of YidC captures the substrate polypeptide with high conformational flexibility . This initial binding occurs rapidly, within approximately 2 milliseconds, and establishes a kinetically stable complex that prevents premature folding or aggregation of the substrate in the aqueous environment. During this phase, YidC recognizes specific features of the substrate, likely including hydrophobic segments that are destined to become transmembrane domains.

Substrate Positioning and Groove Engagement (2-52 ms): Following initial capture, YidC undergoes conformational changes that position the substrate for membrane insertion . The hydrophilic groove of YidC plays a critical role during this phase by providing an energetically favorable environment for hydrophilic segments of the substrate to traverse the membrane. Concurrently, YidC induces local thinning and distortion of the membrane bilayer in its vicinity, which reduces the energetic barrier for insertion.

Lateral Release and Folding: As the substrate transitions into the membrane, it adopts its final folded conformation and is laterally released from YidC into the lipid bilayer . This step is facilitated by the favorable interactions between the hydrophobic segments of the substrate and the membrane lipids. After release, the inserted protein shows significantly reduced conformational variability typical of transmembrane α-helical proteins.

A key feature distinguishing YidC from the Sec translocase is that YidC does not form a complete aqueous channel across the membrane and does not directly require ATP hydrolysis . Instead, it functions as a "membrane-thinning" insertase that reduces the energy barrier for membrane crossing. This mechanism is particularly efficient for smaller membrane proteins with limited periplasmic domains.

Recent studies have identified YibN as a significant interactor of YidC that enhances its insertase activity . In vitro translation/insertion assays using inverted membrane vesicles demonstrated that YibN enrichment resulted in a 1.5-1.8-fold stimulation of insertion for various substrate proteins including Pf3 coat, M13 procoat H5, and F0c. This suggests that auxiliary factors may modulate YidC activity through mechanisms that are still being elucidated.

How does YidC interact with other components of the bacterial protein insertion machinery?

YidC operates both independently and in coordinated networks with other components of the bacterial protein insertion machinery, forming a complex and adaptable system for membrane protein biogenesis:

YidC-SecYEG Interaction: YidC physically associates with the SecYEG translocon to form a hybrid translocase/insertase complex . In this arrangement, YidC is positioned to receive nascent transmembrane domains emerging laterally from the SecY channel and assist in their folding and proper orientation within the membrane. This cooperation is particularly important for membrane proteins with large periplasmic domains that require SecA-dependent translocation across the membrane while simultaneously inserting transmembrane segments into the lipid bilayer.

YidC-SRP Interaction: The signal recognition particle (SRP) pathway delivers many nascent membrane proteins to YidC in a co-translational manner . The SRP receptor (FtsY) facilitates the transfer of ribosome-nascent chain complexes to YidC, allowing for the insertion of membrane proteins as they are being synthesized. This co-translational insertion prevents premature folding or aggregation of hydrophobic segments in the cytoplasm.

YidC-YibN Interaction: Recent evidence identifies YibN as a significant functional partner of YidC with implications for membrane protein insertion efficiency . In vitro assays have shown that YibN stimulates the insertion activity of YidC by 1.5-1.8 fold for various substrate proteins. Experimental data indicates that YibN enhances the insertion of both SecG in its normal orientation and an inverted form, suggesting it plays a general role in facilitating YidC function rather than being substrate-specific.

YidC-Ribosome Interaction: YidC directly interacts with translating ribosomes through its cytoplasmic domains, facilitating co-translational insertion of membrane proteins . This interaction positions the nascent polypeptide exit tunnel of the ribosome in proximity to the YidC insertion site, allowing for efficient transfer of the emerging polypeptide directly into the YidC hydrophilic groove.

Integration with Stress Response Systems: YidC function is coordinated with various stress response pathways, particularly those involved in maintaining membrane protein homeostasis . Under conditions that challenge membrane integrity or protein folding, regulatory systems may modulate YidC expression or activity to adapt to changing cellular needs.

The complex interplay between YidC and these various components creates a versatile system capable of handling diverse membrane protein substrates with different topologies and requirements for insertion. Understanding these interactions is crucial for developing a complete picture of membrane protein biogenesis in bacteria and potentially identifying novel targets for antimicrobial therapy.

What high-resolution techniques are most effective for studying YidC-substrate interactions?

High-resolution techniques have transformed our understanding of YidC-substrate interactions by providing unprecedented insights into the dynamics, kinetics, and structural aspects of the insertion process:

Single-Molecule Force Spectroscopy (SMFS): This technique allows for the direct measurement of forces involved in YidC-substrate interactions at the single-molecule level . By attaching one end of a substrate protein to a surface and the other end to an AFM cantilever or optical tweezers, researchers can measure the forces required to unfold and extract the substrate from YidC. These measurements have revealed that YidC provides stabilizing interactions with substrate proteins during the insertion process, with measurable binding energies that change as the substrate transitions from the bound to the inserted state.

Single-Molecule Fluorescence Spectroscopy: Fluorescence resonance energy transfer (FRET) between strategically placed fluorophores on YidC and its substrates allows for real-time monitoring of the insertion process . This approach has demonstrated that YidC binds substrate proteins within 2 ms and completes the insertion process within approximately 52 ms. By analyzing the FRET efficiency distributions, researchers can assess the conformational variability of the substrate during different stages of insertion, providing insights into the dynamic nature of the process.

Cryo-Electron Microscopy (Cryo-EM): This structural technique has been used to visualize YidC-ribosome complexes and YidC-substrate complexes at near-atomic resolution . These structures provide snapshots of the insertion process, showing how YidC positions itself relative to the ribosome exit tunnel and how it accommodates the nascent polypeptide. The ability to capture different states of the insertion process allows researchers to create a structural "movie" of YidC-mediated membrane protein integration.

Site-Directed Crosslinking: By introducing photo-activatable or chemical crosslinkers at specific positions in YidC and its substrates, researchers can trap transient interaction states that would otherwise be difficult to capture . Analysis of the crosslinked products by mass spectrometry or immunoblotting identifies specific residues involved in YidC-substrate interactions. This approach has been valuable for mapping the pathway of substrate proteins through YidC and identifying key contact points during the insertion process.

In Vitro Translation/Insertion Assays with Inverted Membrane Vesicles: While not a high-resolution technique in the traditional sense, these assays provide valuable functional data that complement structural studies . By using inverted membrane vesicles with different levels of YidC or its interaction partners (such as YibN), researchers can quantitatively assess how these factors affect the efficiency of membrane protein insertion for various substrates. Recent studies using this approach have revealed that YibN stimulates YidC-mediated insertion by 1.5-1.8 fold for several substrate proteins.

Molecular Dynamics Simulations: Computational approaches have become increasingly powerful tools for studying YidC function, allowing researchers to model how YidC interacts with substrates and the membrane at atomic resolution over physiologically relevant timescales . These simulations have provided insights into how YidC distorts the membrane to facilitate insertion and how substrate proteins transition from a hydrophilic to a hydrophobic environment during the insertion process.

The integration of these complementary techniques has provided a comprehensive understanding of YidC function that would not be possible with any single approach. Together, they have transformed our view of YidC from a static structural entity to a dynamic molecular machine that orchestrates the precise placement and folding of membrane proteins.

What is the evolutionary relationship between YidC and SecY, and what does it reveal about membrane protein insertion systems?

The discovery of a striking structural similarity between YidC and SecY has revealed an unexpected evolutionary relationship that provides profound insights into the origin and diversification of membrane protein insertion machinery:

Structural Homology Despite Sequence Divergence: Despite limited sequence similarity, YidC and SecY share a conserved structural motif consisting of a hairpin-interrupted three-transmembrane helix arrangement . Each consensus helix from the YidC family can be matched to a consensus helix from proto-SecY with the same connectivity, suggesting a common ancestral origin. This structural homology is particularly significant because it has persisted despite these proteins having diverged before the last universal common ancestor of all current life forms.

Half-Channel vs. Complete Channel: YidC functions as a "half-channel" that is open to the cytoplasm and penetrates only partially into the membrane, while SecY forms a complete transmembrane channel . This difference reflects their complementary roles in membrane protein biogenesis, with YidC specializing in the insertion of simpler membrane proteins with limited periplasmic domains, while SecY handles more complex proteins requiring complete translocation of large hydrophilic segments.

Evolutionary Scenario: The structural and functional data suggest an evolutionary scenario where an ancestral insertase similar to modern YidC gave rise to the more complex SecY translocon through gene duplication and diversification events . This model proposes that the earliest cellular membranes utilized simpler insertion mechanisms that did not require complete transmembrane channels, and the evolution of more complex membrane proteins drove the selection for more sophisticated translocon systems.

Half-Channel Hypothesis: Supporting this evolutionary model is the observation that YidC can be considered a "half-channel" capable of forming a near-complete channel through antiparallel homodimerization . This concept is further supported by observations in the ERAD (ER-associated degradation) machinery, where Hrd1 and Der1 each display hydrophilic grooves that, when juxtaposed, form a nearly continuous hydrophilic pore. This suggests that proto-SecY may have evolved from a YidC-like insertase through gene duplication and fusion events that created a complete channel from two half-channels.

Conservation Across Domains of Life: The presence of YidC homologs in all domains of life (YidC in bacteria, Oxa1 in mitochondria, Alb3 in chloroplasts) indicates that this insertase family predates the diversification of cellular life . The conservation of both YidC and SecY systems across bacteria, archaea, and eukaryotes suggests that both systems were present in the last universal common ancestor and have been maintained due to their complementary roles in membrane protein biogenesis.

This evolutionary relationship between YidC and SecY provides a conceptual framework for understanding the origin and diversification of membrane protein insertion systems. It suggests that the fundamental mechanisms of membrane protein biogenesis were established early in the evolution of cellular life and have been conserved with modifications across all domains of life. This perspective not only enriches our understanding of the evolutionary history of essential cellular machinery but also provides insights that may guide the development of new approaches to study and potentially target these systems.

What are the implications of targeting YidC for antibacterial drug development?

YidC represents a promising target for novel antibacterial therapeutics due to several key attributes that make it particularly attractive for drug development efforts:

Essential Nature and Limited Redundancy: YidC is essential for bacterial viability, as demonstrated by growth inhibition following its depletion in various bacterial species including E. coli and Salmonella typhimurium . Unlike some other potential targets, bacteria possess limited functional redundancy for YidC-mediated protein insertion, making resistance through pathway switching less likely. Antisense RNA silencing experiments have confirmed that even partial reduction of YidC levels significantly impairs bacterial growth, indicating that complete inhibition may not be necessary for an antibacterial effect .

Conservation Among Pathogens: YidC is highly conserved among bacterial pathogens, suggesting that inhibitors developed against one species' YidC might also be effective against other Gram-negative pathogens . The essential regions of YidC that could serve as drug targets are constrained by functional requirements, potentially limiting the ability of bacteria to evolve resistance through target modification without compromising fitness.

Differences from Eukaryotic Homologs: Despite sharing evolutionary origins with eukaryotic homologs like Oxa1 and Alb3, bacterial YidC exhibits sufficient structural and functional differences to potentially allow for selective targeting . These differences are particularly pronounced in the hydrophilic groove and cytoplasmic domains, which are critical for YidC function and represent potential binding sites for inhibitors.

Synergistic Potential: Experimental evidence shows that YidC depletion sensitizes bacteria to certain antibacterial compounds, including essential oils like eugenol and carvacrol . Fractional Inhibitory Concentration Indices (FICIs) indicate a high level of synergy between YidC silencing and treatment with these compounds, suggesting that YidC inhibitors could potentiate the effects of existing antibiotics. This synergistic approach could allow for lower doses of traditional antibiotics, potentially reducing side effects and slowing the development of resistance.

Potential Mechanisms of Action for YidC Inhibitors:

  • Disruption of the hydrophilic groove to prevent substrate accommodation

  • Interference with the initial binding of substrate proteins to the cytoplasmic domains

  • Prevention of YidC-SecYEG or YidC-YibN interactions to disrupt coordinated insertion pathways

  • Stabilization of non-functional conformations that prevent the necessary structural changes during the insertion process

Current Status and Challenges: As there are no known specific YidC inhibitors yet, this represents a completely novel class of potential antibacterials with a unique mechanism of action . Significant challenges include designing molecules that can penetrate the bacterial outer membrane to reach YidC in the inner membrane, particularly in Gram-negative pathogens like Salmonella typhimurium. Another challenge is achieving selectivity for bacterial YidC over eukaryotic homologs to minimize potential toxicity to host cells.

The development of YidC inhibitors represents a promising frontier in antibacterial drug discovery, particularly relevant in the context of increasing resistance to conventional antibiotics. The essential nature of YidC and its conservation among pathogens make it an attractive target, while the synergistic effects observed with other antibacterial agents highlight its potential in combination therapies.

How does the depletion of YidC affect bacterial membrane proteome and cellular functions?

The depletion of YidC has profound and multifaceted effects on bacterial membrane proteome composition and various cellular functions, revealing the extensive role of this insertase in maintaining bacterial physiology:

Membrane Protein Integration Defects: YidC depletion leads to decreased levels of numerous membrane proteins, including subunits of respiratory complexes, ATP synthase components, and various transporters . Proteins with specific topological features, such as those with single transmembrane segments or small periplasmic domains, are particularly affected, as these often rely exclusively on YidC for membrane insertion. This selective impact on the membrane proteome results in a cascade of functional deficits across multiple cellular systems.

Energy Metabolism Disruption: One of the most significant consequences of YidC depletion is the disruption of respiratory chain assembly and function . Components of respiratory complexes show reduced membrane integration, leading to compromised electron transport and ATP synthesis. This energy deficit affects numerous cellular processes dependent on ATP or proton motive force, creating cascading effects throughout bacterial metabolism and contributing significantly to growth inhibition.

Membrane Integrity and Permeability Changes: YidC depletion leads to alterations in membrane composition and organization, affecting membrane integrity and permeability . These changes can increase bacterial susceptibility to membrane-active antimicrobial agents, as demonstrated by the synergistic effects observed with essential oils like eugenol and carvacrol. Fractional Inhibitory Concentration Indices (FICIs) indicate a high level of synergy between YidC silencing and treatment with these compounds, suggesting that compromised membrane integrity is a major consequence of YidC depletion.

Protein Secretion and Virulence Factor Expression: Beyond its role in membrane protein insertion, YidC influences the assembly and function of secretion systems required for the export of virulence factors in pathogenic bacteria like Salmonella typhimurium . This affects the bacteria's ability to establish infection and interact with host cells, potentially reducing virulence. Studies in Salmonella have shown connections between YidC function and specific virulence mechanisms, highlighting its importance in pathogenicity.

Stress Response Activation: YidC depletion triggers various stress response pathways, including the envelope stress response regulated by the sigma factor σE . Heat shock proteins and other chaperones are upregulated, reflecting the accumulation of misfolded or uninserted membrane proteins. These stress responses represent bacterial attempts to mitigate the consequences of impaired membrane protein insertion but ultimately cannot compensate for the essential function of YidC.

Cell Division and Morphology Defects: Depletion of YidC affects cell division processes, often resulting in elongated cells or aberrant morphologies . This effect may be due to the dependence of certain cell division proteins on YidC for proper membrane insertion and function. The combination of divisional defects with compromised membrane integrity can lead to increased cell lysis and death, explaining the bactericidal effect of YidC inhibition.

These comprehensive effects of YidC depletion highlight its central role in maintaining bacterial membrane proteome composition and cellular functions. The broad impact on energy metabolism, membrane integrity, and essential cellular processes explains why YidC is indispensable for bacterial viability and underscores its potential as an antibacterial target. The synergistic effects observed between YidC depletion and certain antibacterial compounds suggest promising strategies for therapeutic intervention targeting this essential cellular machinery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.