Recombinant Salmonella typhimurium NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella typhimurium NADH-Quinone Oxidoreductase Subunit A (NuoA)

NADH-quinone oxidoreductase subunit A (NuoA) is a key component of the NADH-quinone oxidoreductase (NDH-1) complex found in bacteria such as Salmonella typhimurium . NDH-1, also known as complex I, is a large enzyme complex in the respiratory chain that catalyzes electron transfer from NADH to quinone, coupled with proton translocation across the cytoplasmic membrane .

  • Nomenclature and Synonyms NuoA is also known as NADH:ubiquinone oxidoreductase, membrane subunit A. The gene name for NuoA is nuoA .

  • Biological Function NuoA is involved in oxidoreductase activity, specifically acting on NADH or NADPH . NDH-1 shuttles electrons from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain . The enzyme transfers electrons to ubiquinone and couples the redox reaction to proton translocation, conserving redox energy in a proton gradient . For every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane .

  • Cellular Location NuoA is located in the cell inner membrane as a multi-pass membrane protein .

Role in Bacterial Pathogenesis and Stress Response

NuoA and the NDH-1 complex play a role in bacterial survival under stress conditions.

  • NDH-1 is required for the anaerobic respiration of NADH, using fumarate or DMSO as terminal electron acceptors, which implies that the enzyme can transfer electrons to menaquinone .

  • Low molecular weight thiols, such as glutathione (GSH), can diminish the nitrosative stress experienced by enzymes such as glutamine oxoglutarate amidotransferase and preserve the transcription of Salmonella pathogenicity island 2 gene targets from the inhibitory activity of nitrogen oxides .

Inhibitors and Binding Sites

The NADH-quinone oxidoreductase is sensitive to inhibitors like rotenone and piericidin A .

  • The PSST subunit (NQO6 in bacteria) has a conserved inhibitor-binding site and plays a key role in electron transfer by functionally coupling iron-sulfur cluster N2 to quinone .

  • Photoaffinity labeling studies have identified the high-affinity binding site of PSST, which is exceptionally sensitive to high-potency inhibitors .

Experimental Studies and Research Findings

Experimental studies have provided insights into the function and structure of NuoA and the NDH-1 complex.

  • Specific chemical modification explores the dynamic structure of the NqrB subunit in Na+-pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae .

  • Evolved E. coli strains adapted to higher NADPH production contain an E183A mutation in NuoF; NDH-1 containing this subunit can oxidize both NADH and NADPH .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; STM2328; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, conserving energy as a proton gradient.
Database Links

KEGG: stm:STM2328

STRING: 99287.STM2328

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Why is nuoA significant in bacterial respiratory systems?

NuoA contributes to the proton-pumping function of NDH-1, which is the only proton-pumping NADH dehydrogenase in Salmonella's respiratory chain . Unlike the type II NADH dehydrogenase (encoded by ndh), NDH-1 translocates protons across the membrane to generate a proton motive force, making cells with functional NDH-1 energetically more efficient . This energy conservation is critical for various cellular processes including:

  • ATP synthesis via F₁F₀ ATP synthase

  • Active transport of nutrients across the cytoplasmic membrane

  • Export of unwanted solutes

  • Biogenesis and rotation of the flagellum

The significance of nuoA becomes evident in mutational studies where disruptions to the protein affect bacterial motility, growth, and electron transfer capabilities .

What expression systems are most effective for producing recombinant Salmonella nuoA protein?

The optimal expression systems for recombinant nuoA production include:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, genetic similarity to Salmonella, established protocolsMay require specific strain selection for membrane proteins
YeastPost-translational modifications, good for membrane proteinsLonger production time, potential glycosylation differences
BaculovirusEfficient for membrane proteins, higher eukaryotic processingHigher cost, more complex setup
Mammalian cell systemsNative-like folding for functional studiesLowest yield, highest complexity

For recombinant nuoA production, E. coli expression systems are most commonly employed due to the genetic similarity between E. coli and Salmonella typhimurium . When expressing nuoA, researchers typically include a histidine tag to facilitate purification . The recombinant protein is often stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage .

How can researchers verify the functionality of recombinant nuoA protein?

Verification of recombinant nuoA functionality requires multiple approaches:

  • Enzymatic activity assays: Measuring electron transfer from NADH to various quinones:

    • NADH-oxidase activity assay

    • NADH-DB (dichlorophenolindophenol) reductase assay

    • NADH-K₃Fe(CN)₆ reductase assay

  • Membrane incorporation assessment: Confirming proper integration into lipid membranes using:

    • Liposome reconstitution experiments

    • Blue native PAGE for complex formation

    • Immunoblotting with anti-nuoA antibodies

  • Complementation studies: Introducing the recombinant protein into nuoA deletion mutants to assess restoration of:

    • Growth defects in minimal media

    • Motility in soft agar

    • Respiratory chain activity

Scientists typically use the inhibitor capsaicin-40 as a control, with IC₅₀ values of 132-151 nM for wild-type NDH-1 activity .

How do mutations in nuoA affect Salmonella pathogenicity and metabolism?

Mutations in nuoA have profound effects on Salmonella typhimurium pathogenicity and metabolism:

AspectImpact of nuoA MutationsResearch Evidence
MotilitySignificantly reduced swimming in soft tryptone agarStrains with mutated NDH-1 components showed poor motility due to impaired energy production for flagellar rotation
GrowthImpaired growth, especially on non-fermentable carbon sourcesGrowth defects observed particularly with L-malate as a sole carbon source
RespirationAltered electron flow and dependence on alternative quinonesStrains with impaired NDH-1 function showed increased reliance on demethylmenaquinone and menaquinone instead of ubiquinone
VirulencePotentially reduced fitness in host environmentsProper respiratory function is critical during infection; disruptions affect adaptation to host-imposed stresses

Research demonstrates that nuoA disruption affects the ability of Salmonella to adapt to different environmental conditions, potentially influencing infection dynamics .

What is known about the structural interactions between nuoA and other subunits of the NDH-1 complex?

The structural interactions between nuoA and other NDH-1 subunits are complex and critical for enzyme function:

  • Membrane domain associations: NuoA interacts closely with other membrane-embedded subunits, particularly NuoH, NuoJ, NuoK, NuoM, and NuoN to form proton translocation channels .

  • Interaction with peripheral domain: Though primarily membrane-embedded, nuoA also forms contacts with the hydrophilic domain containing subunits like NuoG .

  • Quinone binding pocket contribution: While nuoA itself does not directly form the quinone binding site, mutations in adjacent subunits (like nuoG, nuoM, and nuoN) can affect quinone interactions and electron transfer efficiency .

Recent research employing suppressor mutations has revealed unexpected connections between nuoA function and other subunits. For example, when ubiquinone biosynthesis is disrupted, specific mutations in nuoG (Q297K), nuoM (A254S), and nuoN (A444E) can partially rescue electron flow through NDH-1, suggesting complex allosteric interactions between these subunits and nuoA within the respiratory complex .

How does the electron transfer mechanism involving nuoA function under different respiratory conditions?

The electron transfer mechanism involving nuoA varies significantly under different respiratory conditions:

Respiratory ConditionElectron Transfer MechanismQuinone Preference
AerobicNADH → FMN → Fe-S clusters → UbiquinonePrimary: Ubiquinone
MicroaerobicMixed electron flow through both pathwaysUbiquinone and Demethylmenaquinone
AnaerobicNADH → FMN → Fe-S clusters → Alternative quinonesPrimary: Demethylmenaquinone, Menaquinone

Under aerobic conditions, nuoA participates in the NDH-1 complex to facilitate electron transfer from NADH ultimately to ubiquinone, which serves as the primary electron acceptor . In contrast, under anaerobic conditions, Salmonella shifts toward using demethylmenaquinone and menaquinone as alternative electron carriers .

This flexibility allows Salmonella to adjust its respiratory chain according to available electron acceptors. Interestingly, research with ubiquinone biosynthesis mutants (ΔubiA or ΔubiE) has shown that NDH-1 containing nuoA can adapt to utilize alternative quinones, though with reduced efficiency . This adaptation is crucial for Salmonella's ability to survive in diverse host environments during infection .

What techniques are most effective for studying nuoA mutations and their phenotypic effects?

Several complementary techniques have proven effective for studying nuoA mutations:

  • Gene deletion and complementation:

    • Construction of precise nuoA deletion mutants using λ-Red recombination

    • Complementation with plasmid-expressed wild-type or mutant nuoA

    • Phenotypic analysis of swimming motility in soft tryptone agar

  • Suppressor mutation screening:

    • Selection of spontaneous suppressor mutants that rescue growth/motility defects

    • Whole-genome sequencing to identify compensatory mutations

    • Site-directed mutagenesis to confirm causative mutations

  • Biochemical characterization:

    • Membrane preparation and enzyme activity assays

    • Analysis of quinone composition by reversed-phase HPLC

    • Immunoblotting to quantify protein expression levels

A particularly valuable approach combines these methods: researchers first construct a nuoA deletion, then screen for suppressor mutations, identify them through sequencing, and finally confirm their effects through biochemical characterization .

How can researchers utilize recombinant nuoA in vaccine development research?

Recombinant nuoA has potential applications in vaccine development research through several approaches:

  • Live attenuated Salmonella vaccine vectors:

    • Modification of nuoA to create attenuated Salmonella strains

    • Use of attenuated strains expressing nuoA as part of multivalent vaccines

    • Evaluation of immune responses to nuoA-containing constructs

  • Subunit vaccine development:

    • Purified recombinant nuoA as a potential antigenic target

    • Analysis of immunogenicity and protective capacity

    • Combination with other Salmonella antigens for enhanced protection

  • Adjuvant research:

    • Investigation of nuoA's potential as an immune-stimulating component

    • Evaluation of its ability to enhance responses to other antigens

    • Comparison with other bacterial proteins for adjuvant properties

Researchers have shown that attenuated Salmonella strains can serve as effective vaccine vectors for delivering passenger antigens to mucosal sites, inducing humoral, cellular, and mucosal immunity . The proper functioning of the respiratory chain, which includes nuoA, is critical for the optimal performance of these vaccine vectors .

What regulatory considerations apply to research involving recombinant Salmonella nuoA?

Research involving recombinant Salmonella nuoA must adhere to several regulatory frameworks:

  • NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules:

    • Most recombinant work with Salmonella falls under Sections III-D, III-E, or III-F

    • Requires Institutional Biosafety Committee (IBC) approval prior to initiation

    • Specific containment requirements based on risk assessment

  • Biosafety considerations:

    • Salmonella typhimurium is typically classified as a Risk Group 2 organism

    • Work requires at minimum Biosafety Level 2 (BSL-2) facilities and practices

    • Additional containment may be needed for certain recombinant constructs

  • Documentation requirements:

    • Detailed research proposal submission to IBC

    • Documentation of safety procedures and containment measures

    • Regular reporting and updates for ongoing work

For experiments involving the alteration of virulence traits or introduction of foreign genes into Salmonella, researchers must adhere to Section III-D-1 of the NIH Guidelines, which requires IBC approval before initiating experiments . This regulatory oversight ensures the safe conduct of research while promoting scientific advancement.

How does nuoA research contribute to understanding bacterial resistance to antimicrobials?

Research on nuoA contributes to understanding antimicrobial resistance through several mechanisms:

  • Energy metabolism and antibiotic tolerance:

    • NDH-1 function affects bacterial persistence during antibiotic exposure

    • Altered respiratory chain activity can influence susceptibility to certain antibiotics

    • NuoA mutations can affect proton motive force-dependent drug efflux systems

  • Metabolic adaptation during infection:

    • Understanding how nuoA contributes to Salmonella's adaptation to host environments

    • Identification of potential metabolic vulnerabilities that could be targeted

    • Analysis of respiratory chain function under iron-restricted conditions

  • Novel antimicrobial targets:

    • The structure and function of nuoA present potential drug targets

    • Inhibition of NDH-1 function could impair Salmonella growth and virulence

    • Compounds targeting nuoA interactions might synergize with existing antibiotics

Recent research has shown that the NDH-1 complex is particularly important for Salmonella to cope with iron-restricted conditions during infection, with the complementary NDH-2 (encoded by ndh) being required for adaptation to these conditions . This understanding could lead to novel therapeutic approaches targeting bacterial respiratory chains.

What are the current technical challenges in studying nuoA structure-function relationships?

Researchers face several technical challenges when investigating nuoA structure-function relationships:

ChallengeTechnical LimitationPotential Solutions
Membrane protein crystallizationDifficult to obtain high-resolution structures of membrane proteins like nuoACryo-EM techniques, nanodiscs for stabilization, fusion protein approaches
Complex formationNuoA functions as part of a large multi-subunit complexBlue native PAGE, chemical crosslinking followed by mass spectrometry, protein co-expression systems
Functional reconstitutionMaintaining native-like activity after purificationLiposome reconstitution, nanodiscs, supported lipid bilayers
Site-specific mutagenesisDetermining which residues are critical for functionAlanine scanning, suppressor mutation analysis, evolutionary conservation mapping

Current approaches to address these challenges include using suppressor mutations to identify functional interactions between subunits, as demonstrated in studies where mutations in nuoG, nuoM, or nuoN partially rescued function in ubiquinone biosynthesis mutants . Additionally, researchers are employing comparative genome sequence analysis to identify evolutionarily conserved residues that may be critical for nuoA function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.