Recombinant Salmonella typhimurium NADH-quinone oxidoreductase subunit K (nuoK)

What is the structure and characteristics of Recombinant Salmonella typhimurium NADH-quinone oxidoreductase subunit K (nuoK)?

Recombinant Salmonella typhimurium NADH-quinone oxidoreductase subunit K (nuoK) is a 100-amino acid protein that forms part of the NADH:quinone oxidoreductase complex (NDH-1). The full amino acid sequence is: MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG . The protein is highly hydrophobic and functions as part of the membrane-embedded domain of the respiratory complex. When expressed recombinantly, it is typically fused to an N-terminal His-tag to facilitate purification and has a molecular weight of approximately 11-12 kDa .

How should researchers optimize expression systems for recombinant nuoK production?

For optimal expression of recombinant nuoK, E. coli BL21(DE3) is the preferred expression system as demonstrated in multiple studies . The gene should be cloned into an expression vector such as pET28a(+) with an N-terminal His-tag for purification purposes. Expression should be induced using IPTG at a concentration of approximately 1 mM . Due to the membrane-associated nature of nuoK, expression conditions must be carefully optimized to prevent protein aggregation and ensure proper folding. Lower induction temperatures (16-25°C) are recommended to slow protein production and allow proper membrane insertion. Additionally, the codon adaptation index should be considered when designing the expression construct, with values around 0.92 being reported as effective for Salmonella proteins expressed in E. coli .

What are the recommended storage and handling protocols for recombinant nuoK?

For long-term storage of recombinant nuoK protein, the following protocol is recommended: Store the purified protein as a lyophilized powder at -20°C to -80°C . When preparing working solutions, reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal stability, add glycerol to a final concentration of 6-50% and divide into small working aliquots . Avoid repeated freeze-thaw cycles as this significantly reduces protein activity. For short-term usage, aliquots can be stored at 4°C for up to one week . When handling the protein, centrifuge the vial briefly before opening to ensure all content is at the bottom, especially after shipping or long-term storage.

What functional assays can be used to assess nuoK activity?

To assess nuoK activity within the NADH:quinone oxidoreductase complex, several complementary approaches are recommended:

• NADH oxidation assays: Measure the rate of NADH oxidation spectrophotometrically at 340 nm using membrane preparations containing recombinant nuoK incorporated into NDH-1 complexes.

• Electron transfer assays: Assess electron transfer from NADH to various electron acceptors such as:

  • Decylubiquinone (DB)

  • Potassium ferricyanide (K₃Fe(CN)₆)

  • Demethylmenaquinone or menaquinone

• Inhibitor sensitivity tests: Determine the IC₅₀ value for specific NDH-1 inhibitors like capsaicin-40, which can help assess whether nuoK incorporation affects quinone binding affinity .

• Complementation studies: Test the ability of recombinant nuoK to restore respiration and motility in nuoK-deficient bacterial strains .

For all these assays, control experiments with wild-type NDH-1 complexes should be performed in parallel to establish baseline activity values.

How do mutations in nuoK affect respiratory chain function in Salmonella?

Mutations in nuoK and other Nuo subunits can significantly alter respiratory chain function in Salmonella. Based on comparative genome sequence analysis of suppressor mutants, single missense mutations in various Nuo subunits (including nuoG, nuoM, and nuoN) can rescue motility and respiratory defects in ubiquinone-biosynthesis mutant strains . These mutations allow the NDH-1 complex to more efficiently utilize alternative electron carriers like demethylmenaquinone or menaquinone, compensating for ubiquinone deficiency .

To study the effects of nuoK mutations:

• Generate site-directed mutations in the nuoK gene

• Express the mutant proteins in appropriate Salmonella strains

• Assess respiratory chain activity through oxygen consumption measurements

• Measure electron transfer rates using different quinone substrates

• Evaluate bacterial motility using soft tryptone agar swimming assays

• Analyze growth rates in different carbon sources, particularly those requiring NADH:quinone oxidoreductase activity

These approaches will help establish structure-function relationships within nuoK and determine critical residues for quinone interaction and proton translocation.

What structural and functional relationships exist between nuoK and other membrane subunits of NADH:quinone oxidoreductase?

NuoK functions as part of the membrane domain of NADH:quinone oxidoreductase-1 (NDH-1), interacting closely with other membrane subunits including NuoM and NuoN. These three large subunits (NuoL, NuoM, and NuoN) are homologous to each other and to Na⁺/H⁺ antiporter complex (Mrp) subunits, each containing a putative proton-translocation channel .

The functional relationship between these subunits involves:

Research methodologies to study these relationships include:

• Cross-linking studies to identify interacting residues between subunits

• Molecular dynamics simulations based on available structural data

• Site-directed mutagenesis of conserved residues followed by functional assays

• Cryo-EM structural analysis of intact NDH-1 complexes with and without nuoK

What methods are most effective for studying the membrane topology and insertion of nuoK?

Studying the membrane topology and insertion of nuoK requires specialized techniques due to its highly hydrophobic nature. The most effective methodological approaches include:

• Cysteine scanning mutagenesis: Systematically replace residues with cysteine, then use membrane-impermeable sulfhydryl reagents to determine which residues are accessible from either side of the membrane.

• Fluorescence spectroscopy: Attach fluorescent probes to specific residues and monitor changes in fluorescence properties when the protein inserts into membrane mimetics.

• Proteolytic digestion mapping: Perform limited proteolysis on membrane-embedded nuoK and identify protected fragments by mass spectrometry.

• Computational prediction: Use algorithms that analyze the amino acid sequence (MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG) to predict transmembrane segments .

• GFP-fusion analysis: Create fusion proteins with GFP at different positions and observe cellular localization patterns.

For experimental validation, researchers should:

• Use membrane mimetics that closely resemble bacterial inner membrane composition

• Compare results across multiple techniques to ensure consistent topology mapping

• Validate in silico predictions with in vitro and in vivo experimental data

How can researchers assess the impact of nuoK on electron transfer efficiency in NDH-1?

To assess the impact of nuoK on electron transfer efficiency in NDH-1, researchers should implement a multi-faceted experimental approach:

• Electron transfer rate measurements:

  • Prepare membrane fractions containing wild-type or mutant NDH-1 complexes

  • Measure NADH oxidation rates spectrophotometrically

  • Use different electron acceptors (ubiquinone, demethylmenaquinone, artificial acceptors like K₃Fe(CN)₆)

  • Calculate specific activities normalized to NDH-1 content

• Inhibitor sensitivity profiling:

  • Determine IC₅₀ values for specific NDH-1 inhibitors (e.g., capsaicin-40)

  • Compare inhibitor sensitivity between wild-type and nuoK-modified complexes

  • Analyze changes in quinone-binding site properties

• Quinone pool analysis using HPLC:

  • Extract and separate quinones using reversed-phase HPLC

  • Quantify different quinone species (ubiquinone, menaquinone, demethylmenaquinone)

  • Correlate quinone composition with electron transfer rates

*Activity varies based on specific mutations and growth conditions

What role does nuoK play in Salmonella pathogenesis and survival during infection?

The role of nuoK in Salmonella pathogenesis can be assessed through several methodological approaches:

• Infection models:

  • Construct nuoK knockout mutants and assess their ability to survive within macrophages

  • Use murine infection models to evaluate virulence of nuoK-deficient Salmonella

  • Measure bacterial loads in different organs following infection

• Immunological studies:

  • Evaluate the immunogenicity of recombinant nuoK protein

  • Assess whether antibodies against nuoK provide protection against Salmonella infection

  • Determine if nuoK can be incorporated into subunit vaccine designs

• Stress response analysis:

  • Subject wild-type and nuoK-deficient Salmonella to various stressors (oxidative stress, pH stress, antimicrobial peptides)

  • Monitor growth and survival rates under stress conditions

  • Measure expression of stress-response genes

While specific data on nuoK's role in pathogenesis is limited, research on recombinant Salmonella proteins suggests they can elicit protective immunity. For example, a chimeric recombinant protein vaccination provided 90% and 70% protection against 10LD₅₀ and 100LD₅₀ of S. Typhimurium, respectively . Similar approaches could be applied to study nuoK's contribution to virulence and its potential as a vaccine component.

What are the optimal purification strategies for recombinant nuoK protein?

Purifying membrane proteins like nuoK presents unique challenges due to their hydrophobicity. The following methodological approach is recommended:

• Expression optimization:

  • Express in E. coli BL21(DE3) using pET28a(+) vector with N-terminal His-tag

  • Induce with 1 mM IPTG at lower temperatures (16-20°C) to reduce inclusion body formation

• Membrane extraction:

  • Harvest cells and disrupt by sonication or French press

  • Separate membrane fraction by ultracentrifugation

  • Solubilize membranes using appropriate detergents (n-dodecyl-β-D-maltoside or CHAPS at 1-2%)

• Affinity chromatography:

  • Purify using Ni-NTA resin leveraging the N-terminal His-tag

  • Use imidazole gradient elution (20-250 mM)

  • Include detergent in all buffers to maintain protein solubility

• Quality assessment:

  • Confirm purity by SDS-PAGE (should be >90%)

  • Verify identity by Western blotting using anti-His antibodies

  • Assess functional integrity through electron transfer assays

• Storage:

  • Store in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Add glycerol (final concentration 5-50%)

  • Aliquot and store at -20°C/-80°C to avoid freeze-thaw cycles

How can researchers effectively reconstitute nuoK into proteoliposomes for functional studies?

Reconstituting nuoK into proteoliposomes provides a controlled environment for functional studies. The following methodology is recommended:

• Liposome preparation:

  • Prepare liposomes using E. coli polar lipid extract or synthetic phospholipids

  • Create unilamellar vesicles by extrusion through polycarbonate filters (100-200 nm)

  • Adjust lipid composition to mimic bacterial inner membrane

• Protein incorporation:

  • Add purified nuoK protein to preformed liposomes at protein:lipid ratios of 1:50 to 1:200

  • Use detergent-mediated reconstitution with controlled detergent removal via:

    • Bio-Beads SM-2 adsorption

    • Dialysis against detergent-free buffer

    • Gel filtration

• Verification of incorporation:

  • Confirm incorporation by:

    • Sucrose density gradient centrifugation

    • Freeze-fracture electron microscopy

    • Dynamic light scattering for size analysis

• Functional assessment:

  • Measure proton translocation using pH-sensitive fluorescent dyes

  • Assess electron transfer capability when co-reconstituted with other NDH-1 subunits

  • Evaluate membrane potential generation using voltage-sensitive dyes

This reconstitution system allows for controlled studies of nuoK function, including the effects of mutations, lipid environment variations, and interactions with other NADH:quinone oxidoreductase subunits.

What bioinformatic approaches are useful for analyzing nuoK sequence conservation and functional domains?

For comprehensive bioinformatic analysis of nuoK, researchers should employ the following methodological approaches:

• Sequence alignment and conservation analysis:

  • Perform multiple sequence alignment of nuoK homologs across bacterial species

  • Identify highly conserved residues likely crucial for function

  • Use tools like CLUSTAL Omega, MUSCLE, or T-Coffee

  • Calculate conservation scores for each position in the alignment

• Structural prediction and modeling:

  • Generate 3D structural models using:

    • Homology modeling based on related structures (e.g., NuoK homologs from E. coli or T. thermophilus)

    • Ab initio modeling for unique regions

    • Validate models using Ramachandran plots (aim for >90% residues in favored regions)

• Transmembrane topology prediction:

  • Predict membrane-spanning regions using algorithms like TMHMM, HMMTOP, or TOPCONS

  • Identify cytoplasmic and periplasmic loops

  • Analyze amphipathicity of transmembrane helices

• Functional domain identification:

  • Identify putative proton translocation channels

  • Locate potential quinone-binding residues

  • Predict protein-protein interaction interfaces with other NDH-1 subunits

• Evolutionary analysis:

  • Construct phylogenetic trees to trace nuoK evolution

  • Identify selection pressures on different protein regions

  • Compare with other NDH-1 subunits to identify co-evolving residues

These bioinformatic approaches provide a foundation for experimental design, helping researchers target specific residues or regions for mutagenesis studies and functional characterization.

What controls should be included when studying recombinant nuoK function?

When designing experiments to study recombinant nuoK function, the following controls are methodologically essential:

• Expression and purification controls:

  • Empty vector control (transformed with expression vector lacking nuoK gene)

  • His-tagged control protein (unrelated protein with similar size and His-tag)

  • Wild-type nuoK protein as positive control

  • Denatured nuoK protein to distinguish specific from non-specific effects

• Functional assay controls:

  • Membrane preparations from nuoK-deficient strains

  • Known inhibitors of NADH:quinone oxidoreductase (e.g., capsaicin-40, rotenone)

  • Measurements with alternative electron acceptors (K₃Fe(CN)₆) to bypass quinone-dependent steps

  • Temperature controls to distinguish enzymatic from non-enzymatic reactions

• Genetic complementation controls:

  • Complementation with wild-type nuoK gene

  • Complementation with empty vector

  • Complementation with point mutants to identify critical residues

• Specificity controls:

  • Other NADH:quinone oxidoreductase subunits expressed and purified under identical conditions

  • Different quinone substrates to assess specificity (ubiquinone, menaquinone, demethylmenaquinone)

Inclusion of these controls ensures that observed effects are specifically attributable to nuoK function rather than experimental artifacts or contaminating activities.

How can researchers effectively study nuoK interactions with other NADH:quinone oxidoreductase subunits?

To effectively study nuoK interactions with other NADH:quinone oxidoreductase subunits, researchers should employ the following methodological approaches:

• Co-expression and co-purification studies:

  • Design constructs for co-expression of nuoK with other subunits (particularly NuoM and NuoN)

  • Use dual-tagging strategies (e.g., His-tag on nuoK, FLAG-tag on interacting partners)

  • Perform tandem affinity purification to isolate intact complexes

  • Analyze complex composition by SDS-PAGE and mass spectrometry

• Crosslinking experiments:

  • Apply chemical crosslinkers with varying spacer arm lengths to identify proximity relationships

  • Use photo-crosslinking with site-specifically incorporated photo-reactive amino acids

  • Analyze crosslinked products by mass spectrometry to identify interaction interfaces

• FRET/BRET analysis:

  • Create fusion proteins with appropriate fluorescent or bioluminescent tags

  • Measure energy transfer as indication of protein-protein proximity

  • Perform competition experiments with untagged proteins

• Bacterial two-hybrid assays:

  • Adapt membrane-specific bacterial two-hybrid systems to detect nuoK interactions

  • Screen for interactions with other NDH-1 subunits systematically

• Suppressor mutation analysis:

  • Identify compensatory mutations in other subunits that rescue nuoK mutant phenotypes

  • Map these mutations to potential interaction surfaces

These approaches, used in combination, provide a comprehensive picture of nuoK's interactions within the NADH:quinone oxidoreductase complex and help elucidate the functional significance of these interactions.

What are the common challenges in recombinant nuoK expression and how can they be addressed?

Recombinant expression of membrane proteins like nuoK presents several challenges. The following methodological approaches can help address these issues:

• Poor expression levels:

  • Optimize codon usage (aim for CAI ≥ 0.92 for expression in E. coli)

  • Try different expression vectors (pET, pBAD, pTrc)

  • Test various E. coli strains (BL21(DE3), C41(DE3), C43(DE3))

  • Lower induction temperature to 16-20°C

  • Use auto-induction media instead of IPTG induction

• Protein aggregation/inclusion body formation:

  • Express as fusion with solubility enhancers (SUMO, MBP, TrxA)

  • Include mild detergents in lysis buffer (0.1-0.5% Triton X-100)

  • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

  • Perform on-column refolding during purification

• Low protein stability:

  • Optimize buffer composition (try different pH values, ionic strengths)

  • Add stabilizing agents (glycerol, trehalose)

  • Include specific lipids that interact with nuoK

  • Store in smaller aliquots to avoid freeze-thaw cycles

• Improper membrane insertion:

  • Use in vitro translation systems with supplied membrane vesicles

  • Co-express with other membrane subunits that may facilitate proper folding

  • Try E. coli strains with modified membrane compositions

• Verification issues:

  • Use multiple detection methods (anti-His Western blot, mass spectrometry)

  • Confirm activity in a reconstituted system with other NDH-1 subunits

  • Verify membrane localization using fractionation techniques

How can researchers validate that recombinant nuoK is correctly folded and functional?

Validating the correct folding and functionality of recombinant nuoK requires multiple complementary approaches:

• Structural integrity assessment:

  • Circular dichroism spectroscopy to verify secondary structure content

  • Tryptophan fluorescence spectroscopy to assess tertiary structure

  • Limited proteolysis to identify properly folded domains (protected from digestion)

  • Thermal stability assays to measure protein melting temperature

• Membrane integration verification:

  • Membrane fractionation to confirm localization to membrane fractions

  • Flotation assays in density gradients

  • Resistance to extraction by carbonate treatment (indicative of integral membrane proteins)

• Functional validation:

  • Complementation of nuoK-deficient strains (restoration of phenotypes)

  • Assembly into the NDH-1 complex (verified by BN-PAGE)

  • Support of NADH oxidation activity when incorporated into membranes or proteoliposomes

  • Proton translocation assays using pH-sensitive fluorescent dyes

• Interaction studies:

  • Verify binding to known interacting partners (other NDH-1 subunits)

  • Confirm expected stoichiometry in reconstituted complexes

  • Demonstrate response to specific inhibitors with expected IC₅₀ values

These validation approaches should be applied systematically to ensure that the recombinant nuoK protein faithfully represents the native protein in terms of structure and function.