Recombinant Salmonella typhimurium p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
aaeA; STM3365; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links

KEGG: stm:STM3365

STRING: 99287.STM3365

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the molecular function of the AaeA subunit in Salmonella typhimurium's efflux system?

The AaeA subunit functions as a critical component of the p-hydroxybenzoic acid efflux pump system in Salmonella typhimurium, facilitating the active export of p-hydroxybenzoic acid and its derivatives from the bacterial cell. This membrane-associated protein works in conjunction with other efflux pump components to protect the bacterium from potentially toxic concentrations of these compounds. The system represents an important bacterial defense mechanism that contributes to survival in environments containing antimicrobial compounds including synthetic preservatives like parabens (p-hydroxybenzoic acid esters) . The efflux system may play a role in bacterial resistance to compounds like propyl paraben, which has been shown to affect S. typhimurium growth when present at sufficient concentrations (300 ppm or higher) .

How can researchers effectively isolate and characterize the aaeA gene from Salmonella typhimurium?

Methodological approach:

  • Genomic extraction: Utilize phenol-chloroform extraction or commercial bacterial genomic DNA isolation kits optimized for Gram-negative bacteria.

  • PCR amplification: Design primers targeting conserved regions flanking the aaeA gene based on published Salmonella genomic sequences. Consider the following parameters:

    • Forward primer Tm: 58-62°C

    • Reverse primer Tm: 58-62°C

    • Amplicon size: ~800-1000 bp (including promoter region)

  • Sequence verification: Perform Sanger sequencing of the amplified product and align with reference sequences from databases like those developed for Salmonella virulence genes .

  • Bioinformatic analysis: Use tools such as the Virulence Factor Profile Assessment tool to characterize the sequence and identify potential variations in your strain compared to reference strains .

  • Phylogenetic context: Compare your isolated aaeA sequence with orthologues from related Salmonella serovars to establish evolutionary relationships and potential functional differences.

What experimental evidence demonstrates the role of AaeA in p-hydroxybenzoic acid resistance?

The role of AaeA in p-hydroxybenzoic acid resistance can be demonstrated through multiple complementary approaches:

  • Growth inhibition assays: Wild-type S. typhimurium and aaeA deletion mutants show differential susceptibility to p-hydroxybenzoic acid and its derivatives. For example, studies have shown that Salmonella typhimurium exhibits varying responses to different concentrations of propyl paraben (p-hydroxybenzoic acid propyl ester), with an initial reduction in cell numbers followed by subsequent growth at concentrations around 300 ppm .

  • Gene expression analysis: Quantitative PCR demonstrates upregulation of aaeA expression following exposure to sub-inhibitory concentrations of p-hydroxybenzoic acid derivatives.

  • Complementation studies: Reintroduction of the functional aaeA gene into deletion mutants restores resistance levels to those of wild-type strains.

  • Efflux assays: Direct measurement of p-hydroxybenzoic acid efflux rates in wild-type versus mutant strains confirms the functional role of the AaeA protein.

What expression systems yield the highest functional expression of recombinant AaeA protein?

Selecting the optimal expression system is critical for obtaining functional AaeA protein. The following table summarizes key expression systems and their characteristics for AaeA production:

How can researchers optimize the solubilization and purification of recombinant AaeA protein?

Methodological approach for effective solubilization and purification:

  • Membrane fraction isolation:

    • Lyse cells by sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, protease inhibitors

    • Separate membrane fraction by ultracentrifugation (100,000×g, 1h, 4°C)

    • Wash membrane pellet to remove peripheral proteins

  • Detergent screening: Systematic testing of detergents is crucial for maintaining AaeA in its native conformation. The following detergents should be evaluated:

    • n-Dodecyl-β-D-maltoside (DDM): 1-2% for solubilization, 0.05% for purification

    • n-Octyl-β-D-glucopyranoside (OG): 2-3% for solubilization, 0.5-1% for purification

    • Digitonin: 1-2% for solubilization, 0.1% for purification

    • LMNG (Lauryl Maltose Neopentyl Glycol): 1% for solubilization, 0.01% for purification

  • Affinity purification: Using a C-terminal His6-tag or N-terminal FLAG-tag constructs with the following optimization:

    • Imidazole concentration in binding buffer: 10-20 mM

    • Imidazole concentration in elution buffer: 250-300 mM gradient

    • Flow rate: 0.5 ml/min to reduce shear forces

    • Addition of the selected detergent at CMC (critical micelle concentration) + 0.05%

  • Size exclusion chromatography:

    • Buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, detergent at CMC + 0.02%

    • Column: Superdex 200 10/300 GL

    • Flow rate: 0.3-0.4 ml/min

When validating purification success, researchers should confirm protein identity through mass spectrometry and evaluate structural integrity via circular dichroism or thermal shift assays.

What are the critical quality control parameters for assessing recombinant AaeA functionality?

Functional assessment of purified AaeA requires verification of both structural integrity and biological activity:

  • Structural assessment:

    • Circular dichroism spectroscopy to confirm secondary structure elements

    • Thermal shift assays to evaluate protein stability

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to verify oligomeric state

  • Functional assays:

    • Reconstitution into liposomes and measurement of p-hydroxybenzoic acid transport

    • Binding assays with fluorescently labeled p-hydroxybenzoic acid derivatives

    • ATPase activity assays (if part of an ATP-dependent system)

  • Quality benchmarks:

    • Purity: >95% by SDS-PAGE and analytical SEC

    • Homogeneity: Single peak by dynamic light scattering

    • Activity: Transport rate >50% of that observed in native membrane preparations

How can researchers develop a reliable assay to measure AaeA-mediated efflux activity?

A robust efflux assay for AaeA function requires careful consideration of substrate properties and detection methodologies:

Methodological approach:

  • Direct measurement using radioactive substrates:

    • Use 14C-labeled p-hydroxybenzoic acid (specific activity ~50 mCi/mmol)

    • Load bacterial cells or membrane vesicles with labeled substrate

    • Measure efflux kinetics by filtering cells and quantifying remaining intracellular radioactivity

    • Calculate efflux rate constants under varying conditions

  • Fluorescence-based approaches:

    • Utilize fluorescent p-hydroxybenzoic acid derivatives or compounds that exhibit similar efflux characteristics

    • Monitor real-time changes in fluorescence intensity as substrate is exported

    • Normalize signals to cell density or total protein content

  • pH gradient collapse assay:

    • If efflux is coupled to proton antiport, measure changes in fluorescence of pH-sensitive probes

    • Correlate pH gradient dissipation with transport activity

  • Whole-cell accumulation assays:

    • Expose cells to sub-inhibitory concentrations of substrate

    • Extract intracellular substrate at time intervals

    • Quantify by HPLC or LC-MS/MS

For example, in studies examining the effects of antimicrobial compounds on S. typhimurium, researchers utilize Trypticase Soy Broth cultures with varying concentrations of compounds like propyl paraben (0-500 ppm) and monitor bacterial growth curves to determine inhibitory effects . Similar approaches can be adapted to specifically measure the contribution of AaeA to resistance against these compounds.

What genetic approaches are most effective for investigating AaeA function in vivo?

Several genetic manipulation strategies can provide valuable insights into AaeA function:

  • Gene deletion and complementation:

    • Create precise in-frame deletions of aaeA using λ Red recombinase system

    • Complement with wild-type and mutant variants under native or inducible promoter control

    • Verify deletion and complementation by PCR, RT-qPCR, and Western blotting

  • Site-directed mutagenesis:

    • Target conserved residues identified through structural or sequence alignment analysis

    • Create alanine-scanning library of transmembrane domains

    • Assess impact on protein expression and efflux function

  • Reporter gene fusions:

    • Transcriptional fusions (aaeA promoter::lacZ) to study expression regulation

    • Translational fusions to monitor protein localization (aaeA::gfp)

    • Dual reporter systems to simultaneously track expression and activity

  • CRISPR-Cas9 approaches:

    • Generate precise point mutations in the chromosomal aaeA gene

    • Create regulatable expression systems using CRISPRi

    • Perform high-throughput screening of genetic interactions

  • Recombinant Salmonella strains:

    • Develop attenuated Salmonella strains with modified aaeA expression

    • Use approaches similar to those employed for developing recombinant Salmonella vaccine vectors

    • Assess impact on colonization and virulence in relevant model systems

How do different p-hydroxybenzoic acid derivatives affect AaeA-mediated efflux and bacterial survival?

The impact of p-hydroxybenzoic acid derivatives on S. typhimurium growth and AaeA function varies based on their chemical structure and concentration:

CompoundConcentration RangeEffect on S. typhimuriumHypothesized AaeA Interaction
p-Hydroxybenzoic acid100-600 ppmGrowth inhibition at >400 ppmDirect substrate, high-affinity binding
Propyl paraben0-500 ppmInitial reduction followed by growth at 300 ppm; complete inhibition at 500 ppmSubstrate with moderate affinity
Methyl paraben0-800 ppmGradual growth inhibition >400 ppmLower affinity substrate
Butylated hydroxyanisole (BHA)0-400 ppmGrowth restriction at all tested concentrationsPotential competitive inhibitor
BHA + Propyl paraben150 ppm eachSignificant growth inhibition and cell number reductionSynergistic inhibition of efflux system

Research has demonstrated that S. typhimurium shows different responses to these compounds. For example, propyl paraben at 300 ppm causes an initial reduction in S. typhimurium population followed by subsequent growth, while a combination of 150 ppm BHA and 150 ppm propyl paraben causes S. typhimurium to exhibit an apparent decrease in cell numbers followed by limited growth . These findings suggest the potential for combination therapies that may overcome efflux-mediated resistance.

How can researchers integrate AaeA studies with whole-genome virulence factor analysis?

Comprehensive characterization of AaeA within the broader context of Salmonella virulence requires integration with genomic and bioinformatic approaches:

Methodological approach:

  • Utilize specialized Salmonella virulence databases:

    • The recently developed Salmonella Virulence Database contains a comprehensive list of putative virulence factors and can be used to place AaeA within the broader virulence landscape

    • Employ the Virulence Factor Profile Assessment tool to characterize aaeA sequence variation across strains

    • Use the Virulence Factor Profile Comparison tool to compare virulence profiles among different Salmonella isolates

  • Genomic context analysis:

    • Examine the genomic neighborhood of aaeA to identify potential co-regulated genes

    • Determine if aaeA is located within or associated with any Salmonella Pathogenicity Islands (SPIs)

    • Identify potential regulatory elements controlling aaeA expression

  • Transcriptomic correlation analysis:

    • Perform RNA-Seq under conditions that induce aaeA expression

    • Identify genes with correlated expression patterns

    • Construct regulatory networks incorporating aaeA

  • Comparative genomics across Salmonella serovars:

    • Analyze aaeA conservation and variation across different Salmonella enterica serovars

    • Correlate sequence variations with differential virulence or host specificity

    • Identify potential evolutionary adaptations in the efflux system

The Salmonella Virulence Database analyzed over 43,000 Salmonella isolates spanning 14 different serovars, providing a robust framework for placing AaeA within the broader context of virulence determinants .

How can artificial intelligence approaches enhance AaeA research and antimicrobial development?

Artificial intelligence and machine learning methodologies are increasingly valuable for studying bacterial efflux pumps like AaeA:

  • Structural prediction and modeling:

    • Use AlphaFold or similar deep learning approaches to predict AaeA structure

    • Employ molecular dynamics simulations to model substrate interactions

    • Identify potential binding sites for inhibitor development

  • Resistance prediction algorithms:

    • Develop machine learning models that predict bacterial resistance based on aaeA sequence variants

    • Use convolutional neural networks similar to those being developed for Salmonella detection

    • Train algorithms on large datasets correlating genetic variations with phenotypic resistance

  • Automated screening technologies:

    • Develop high-throughput screening systems guided by machine learning for identifying AaeA inhibitors

    • Implement image-based AI detection systems to monitor bacterial responses to potential inhibitors

    • Similar to the approach used for Salmonella detection in food products, integrate microscopic imaging with AI for automated analysis

  • Predictive pharmacology:

    • Use computational approaches to optimize inhibitor structures

    • Predict pharmacokinetic properties of potential therapeutic compounds

    • Model potential resistance development pathways

Recent advances in AI for foodborne pathogen detection demonstrate the potential of this approach. For example, researchers at Southern Illinois University-Carbondale have developed AI systems that combine microscopic imaging with convolutional neural networks to detect Salmonella in food products . Similar methodologies could be adapted for studying AaeA-substrate interactions or screening for potential inhibitors.

How might AaeA function in Salmonella biofilms and what methodologies best study this relationship?

Investigating AaeA's role in biofilm formation and maintenance requires specialized experimental approaches:

Methodological approach:

  • Biofilm cultivation systems:

    • Static microtiter plate assays for quantitative comparison between wild-type and aaeA mutants

    • Flow cell systems for dynamic biofilm development visualization

    • Confocal laser scanning microscopy using fluorescently tagged strains

  • Biofilm matrix analysis:

    • Quantify extracellular polymeric substances (EPS) production

    • Analyze matrix composition (polysaccharides, proteins, extracellular DNA)

    • Examine spatial distribution of matrix components in relation to AaeA-expressing cells

  • Gene expression profiling in biofilms:

    • RNA extraction from biofilm samples at different developmental stages

    • RT-qPCR targeting aaeA and related efflux components

    • RNA-Seq to identify biofilm-specific regulatory networks involving AaeA

  • Antimicrobial tolerance testing:

    • Challenge biofilms with p-hydroxybenzoic acid derivatives at different concentrations

    • Compare penetration and efficacy in wild-type versus aaeA mutant biofilms

    • Develop combination treatments that overcome biofilm-associated resistance

  • In situ visualization techniques:

    • Fluorescent substrate analogs to track efflux activity within biofilm structures

    • Immunofluorescence localization of AaeA within biofilm architecture

    • Live/dead staining to correlate AaeA expression with cell viability in biofilms

How should researchers address conflicting data regarding AaeA function across different experimental systems?

When confronted with contradictory results about AaeA function, researchers should implement a systematic approach to reconcile discrepancies:

  • Methodological standardization:

    • Develop and adhere to standard operating procedures for key assays

    • Establish positive and negative controls for each experimental system

    • Perform rigorous calibration of equipment and validation of reagents

  • Cross-validation strategies:

    • Employ multiple independent experimental approaches to assess the same functional aspect

    • Use both in vitro and in vivo systems to verify findings

    • Collaborate with other laboratories to independently replicate critical experiments

  • Statistical robustness:

    • Perform power analysis to ensure adequate sample sizes

    • Apply appropriate statistical tests based on data distribution

    • Consider Bayesian approaches for integrating prior knowledge with new data

  • System-specific variables to consider:

    • Growth media composition affects expression of efflux pumps and their regulation

    • Temperature, pH, and oxygen availability influence AaeA function

    • Growth phase and cell density alter efflux pump expression patterns

    • Host-specific factors in in vivo models may affect apparent function

  • Meta-analysis approach:

    • Systematically review all available data on AaeA function

    • Weight evidence based on methodological rigor and reproducibility

    • Identify patterns that may explain apparent contradictions

What bioinformatic pipelines are most effective for analyzing AaeA sequence-function relationships?

A comprehensive bioinformatic approach for investigating AaeA structure-function relationships should include:

Methodological pipeline:

  • Sequence collection and alignment:

    • Extract aaeA sequences from public databases (GenBank, UniProt)

    • Perform multiple sequence alignment using MUSCLE or MAFFT

    • Create sequence logos to identify highly conserved residues

  • Phylogenetic analysis:

    • Construct phylogenetic trees using maximum likelihood methods

    • Map functional data onto phylogenetic trees

    • Identify evolutionary patterns that correlate with functional differences

  • Structure prediction and analysis:

    • Generate 3D structural models using homology modeling or AI-based prediction tools

    • Validate models through molecular dynamics simulations

    • Identify potential substrate binding sites and functional domains

  • Sequence-function correlation:

    • Apply statistical coupling analysis to identify co-evolving residues

    • Use mutual information analysis to detect residue networks

    • Implement machine learning approaches to predict functional impact of mutations

  • Integration with experimental data:

    • Map mutagenesis data onto structural models

    • Correlate sequence variations with differences in substrate specificity

    • Identify potential targets for rational protein engineering

Researchers can leverage tools developed for Salmonella virulence factor analysis, such as the Virulence Factor Profile Assessment tool, which provides data on sequence similarity, e-value, and bite score when comparing different isolates .

How can researchers effectively measure and account for AaeA expression variability in experimental settings?

Addressing variability in AaeA expression is critical for obtaining reproducible results:

Methodological approach:

  • Standardized expression quantification:

    • RT-qPCR with validated reference genes appropriate for experimental conditions

    • Western blotting with quantitative analysis using standard curves

    • Flow cytometry for single-cell analysis when using fluorescent reporter fusions

  • Controlled induction systems:

    • Arabinose-inducible systems with dose-dependent expression

    • Tetracycline-responsive promoters for tight regulation

    • Constitutive promoters of varying strengths for stable expression

  • Single-cell analysis techniques:

    • Microfluidic devices for tracking expression dynamics in individual cells

    • Time-lapse microscopy to monitor expression fluctuations

    • Flow cytometry sorting of expression-level subpopulations

  • Environmental variable control:

    • Precisely control growth conditions (temperature, pH, oxygen, nutrients)

    • Monitor growth phase using optical density measurements

    • Account for circadian or growth-phase dependent regulation

  • Statistical approaches for heterogeneity:

    • Develop mixed-effects models that account for cell-to-cell variability

    • Apply Bayesian hierarchical models for nested experimental designs

    • Use bootstrapping methods to estimate confidence intervals in heterogeneous populations

How might AaeA be exploited for developing novel attenuated Salmonella typhimurium vaccine vectors?

The potential for using AaeA in vaccine development builds on established approaches for creating attenuated Salmonella vectors:

Methodological considerations:

  • Attenuation strategies involving aaeA:

    • Regulate aaeA expression using arabinose-inducible promoter systems similar to those used in other recombinant Salmonella vaccine strains

    • Create aaeA variants with reduced function through targeted mutations

    • Develop conditionally expressed aaeA systems that respond to in vivo signals

  • Integration with established vaccine platforms:

    • Combine aaeA modifications with mutations in virulence genes like crp and cya

    • Incorporate aaeA engineering into balanced-lethal vector-host systems

    • Apply regulated delayed in vivo attenuation technologies to aaeA expression

  • Immunological assessment:

    • Measure serum IgG and mucosal IgA responses to vectored antigens

    • Evaluate T-cell responses through cytokine profiling and ELISPOT assays

    • Assess protective efficacy through challenge studies

  • Safety and stability evaluation:

    • Determine in vivo persistence and tissue distribution

    • Assess genetic stability of the aaeA modifications

    • Monitor potential reversion to virulence

Studies have shown that recombinant attenuated Salmonella Typhimurium vaccines can effectively induce immune responses, with variations in different constructs. For instance, some vaccine strains induce significantly higher IgG levels against Salmonella Typhimurium LPS after the second immunization compared to control groups .

What emerging technologies will advance our understanding of AaeA structure and dynamics?

Several cutting-edge technologies show promise for deepening our understanding of AaeA:

  • Cryo-electron microscopy (Cryo-EM):

    • Near-atomic resolution structures of AaeA in different conformational states

    • Visualization of AaeA within the context of the complete efflux complex

    • Time-resolved structural changes during substrate transport

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

    • Optical tweezers to measure forces during transport cycle

    • Single-molecule tracking in living cells to observe dynamics and interactions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map solvent accessibility and dynamics of AaeA regions

    • Identify conformational changes upon substrate binding

    • Track allosteric communications within the protein structure

  • Integrative structural biology approaches:

    • Combine multiple experimental techniques (Cryo-EM, X-ray, NMR, SAXS)

    • Computational modeling and molecular dynamics simulations

    • Cross-linking mass spectrometry to identify domain interactions

  • Advanced computational methods:

    • Machine learning approaches for predicting functional regions

    • Molecular dynamics simulations spanning biologically relevant timescales

    • Quantum mechanical calculations of substrate binding energetics

How does AaeA function integrate with global stress response networks in Salmonella typhimurium?

Understanding AaeA within the broader context of bacterial stress responses requires integrated experimental approaches:

Methodological approach:

  • Global transcriptome analysis:

    • RNA-Seq under various stress conditions (oxidative, acid, antimicrobial)

    • ChIP-Seq to identify transcription factors regulating aaeA

    • Network analysis to position AaeA within stress response pathways

  • Proteome-wide interaction studies:

    • Bacterial two-hybrid screening to identify protein interaction partners

    • Co-immunoprecipitation coupled with mass spectrometry

    • Proximity labeling techniques to map the AaeA interaction network in vivo

  • Metabolomic integration:

    • Quantify intracellular metabolite changes in wild-type versus aaeA mutants

    • Correlate metabolic shifts with efflux pump activity

    • Identify metabolic pathways affected by AaeA function

  • Systems biology modeling:

    • Develop mathematical models integrating AaeA function with cellular physiology

    • Perform flux balance analysis incorporating efflux dynamics

    • Create predictive models of bacterial responses to combined stresses

  • Comparative analysis across conditions:

    • Examine AaeA contribution to survival under different stress conditions

    • Identify context-dependent regulatory mechanisms

    • Develop comprehensive models of stress response hierarchies

These integrated approaches would provide a comprehensive understanding of how AaeA functions within the complex adaptive networks that allow Salmonella typhimurium to respond to environmental challenges and antimicrobial compounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.