Recombinant Salmonella typhimurium Peptide transport system permease protein sapB (sapB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Antimicrobial Peptide Resistance

The Sap transporter mediates bacterial resistance to host-derived APs (e.g., LL-37) through a two-step mechanism:

  1. Substrate Binding: SapA (periplasmic binding protein) captures APs in the periplasm .

  2. Transport and Degradation: SapB and SapC form a transmembrane channel for AP uptake into the cytoplasm, where they are degraded by proteases .

Key functional insights:

  • SapBC Mutant Sensitivity: Deletion of sapBC in Haemophilus ducreyi increased LL-37 sensitivity by >50%, underscoring SapB’s role in AP resistance .

  • SapA Independence: SapB/C can transport substrates without SapA, albeit less efficiently, suggesting partial autonomy in transport activity .

Research Findings and Mutational Studies

Studies comparing sapA and sapBC mutants revealed:

MutantLL-37 SensitivityVirulence AttenuationMechanism
sapA deletionModerate (~25–50%)Partial (50% reduction)Residual SapBC activity enables limited AP transport .
sapBC deletionSevere (>50%)CompleteLoss of transmembrane channel abolishes AP uptake and degradation .

These findings highlight SapB’s indispensability in bacterial survival under host immune pressure .

Applications in Research

Recombinant SapB is utilized to:

  • Study ABC Transporter Dynamics: Investigate substrate specificity and energy coupling mechanisms .

  • Develop Antimicrobial Strategies: Target SapB to disrupt bacterial AP resistance pathways .

  • Structural Biology: Analyze membrane protein interactions via crystallography or NMR .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
sapB; STM1693; Peptide transport system permease protein SapB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
sapB
Target Protein Sequence
MIIFTLRRLLLLLVTLFFLTFIGFSLSYFTPHAPLQGASLWNAWVFWFNGLLHWDFGVSS INGQLISEQLKEVFPATMELCILAFGFALMVGIPVGMLAGVTRSKWPDRFISALALLGFS IPVFWLALLLTLFFSLTLGWLPVSGRFDLLYEVKPVTGFAIIDAWISDSPWRDEMVMSAI RHMVLPVLTLSVAPTTEVIRLMRISTIEVYDQNYVKAAATRGLSRFTILRRHVLHNALPP VIPRLGLQFSTMLTLAMITEMVFSWPGLGRWLIHAIRQQDYAAISAGVMVIGSLVIVVNV ISDILGAMANPLKHKEWYALR
Uniprot No.

Target Background

Function
The SapB protein is involved in a peptide intake transport system that plays a role in the resistance to antimicrobial peptides.
Database Links

KEGG: stm:STM1693

STRING: 99287.STM1693

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the peptide transport system permease protein SapB and how does it function in Salmonella typhimurium?

SapB is a membrane-associated permease protein that forms part of the peptide transport system in Salmonella typhimurium. It belongs to the ATP-binding cassette (ABC) transporter family and functions as an integral component that facilitates the translocation of specific peptides across the bacterial membrane. This transport system typically consists of multiple proteins working in concert: a substrate-binding protein that captures peptides in the periplasm, membrane-spanning permease proteins like SapB that form the translocation channel, and ATP-binding proteins that provide energy for the transport process through ATP hydrolysis.

The functional characterization of SapB requires biochemical approaches including:

  • Membrane protein isolation using detergent solubilization

  • Reconstitution in proteoliposomes to study transport kinetics

  • ATP hydrolysis assays to measure transporter activity

  • Substrate binding assays using radiolabeled or fluorescently tagged peptides

When studying SapB function, researchers should consider its interaction with other components of the transport complex, as isolated permeases often exhibit limited activity without their partner proteins.

How does SapB differ from other bacterial permease proteins and transport systems?

While SapB shares structural similarities with other bacterial permease proteins, its specificity for particular peptide substrates and its regulation pattern distinguish it from related transporters. The peptide transport system in Salmonella demonstrates important physiological roles that may differ from homologous systems in other bacteria.

Comparative analysis approaches include:

  • Sequence alignment with homologous proteins from related bacteria

  • Phylogenetic analysis to establish evolutionary relationships

  • Substrate specificity profiling using peptide libraries

  • Expression pattern analysis under different growth conditions

Research indicates that bacterial transport systems like SapB often exhibit temporal and spatial regulation dependent on environmental conditions, suggesting sophisticated control mechanisms similar to those observed in the regulation of the streptomycete morphogenetic peptide SapB, which exhibits "multi-tier regulation" including both transcriptional and post-translational control .

What methodologies are appropriate for studying SapB expression patterns in Salmonella?

To characterize SapB expression patterns, researchers can employ:

  • Quantitative RT-PCR to measure transcript levels under various conditions

  • Reporter gene fusions (e.g., sapB-lacZ or sapB-gfp) to monitor expression in real-time

  • Western blotting with anti-SapB antibodies to quantify protein levels

  • Proteomics approaches including mass spectrometry to identify SapB in membrane fractions

Expression analysis should include multiple growth conditions relevant to Salmonella's lifecycle, including:

  • Nutrient limitation conditions

  • Different pH environments

  • Presence of antimicrobial peptides

  • Intracellular-mimicking conditions

  • Growth in various infection models

Similar to the ramS gene in Streptomyces, which shows continuous transcription throughout the cell cycle with a dual expression profile , SapB expression may exhibit complex regulation patterns that require careful temporal analysis.

How should researchers design experiments to study SapB function in the context of Salmonella virulence?

Designing rigorous experiments to understand SapB's role in virulence requires multiple complementary approaches:

Genetic manipulation strategies:

  • Construction of clean deletion mutants (ΔsapB) using lambda Red recombination

  • Complementation studies with wild-type sapB under native or inducible promoters

  • Site-directed mutagenesis to create point mutations in functional domains

  • Construction of conditional mutants for essential functions

Phenotypic characterization methods:

  • Growth curve analysis under standard and stress conditions

  • Survival assays in acidic environment or presence of antimicrobial peptides

  • Biofilm formation quantification

  • Motility assays

Infection model studies:

  • Cell culture invasion and persistence assays

  • Macrophage survival assays

  • Animal infection models with competitive index determination

  • Organ bacterial burden quantification

When designing these experiments, researchers should consider potential functional redundancy with other transport systems, which may mask phenotypes in single deletion mutants. This approach parallels studies of Salmonella sopB mutants, which have been evaluated for effects on the immunogenicity and efficacy of Salmonella vaccine strains .

What are the optimal expression systems and purification strategies for recombinant SapB protein?

Expression systems comparison:

Expression SystemAdvantagesLimitationsYieldFunctionality
E. coli BL21(DE3)High expression, well-establishedMay form inclusion bodies+++Variable
E. coli C41/C43Designed for membrane proteinsLower yield++Good
E. coli with pBAD promoterTight regulation, tunableExpensive inducer++Good
Cell-free systemsAvoids toxicity issuesExpensive, limited scale+Excellent
Native SalmonellaAuthentic modificationsLower yield, pathogenicity concerns+Excellent

Purification strategies:

  • Membrane preparation via differential centrifugation

  • Detergent screening for optimal solubilization (DDM, LMNG, MNG-3)

  • Immobilized metal affinity chromatography with His-tagged constructs

  • Size exclusion chromatography for final purification

  • Functional reconstitution in proteoliposomes or nanodiscs

For structural studies, consider:

  • Addition of stabilizing mutations

  • Use of antibody fragments or nanobodies as crystallization chaperones

  • Thermostability assays to identify optimal buffer conditions

  • Lipid cubic phase crystallization for membrane proteins

These methodologies are similar to those used for other bacterial membrane proteins but must be optimized specifically for SapB characteristics.

What techniques are most appropriate for investigating SapB-mediated peptide transport kinetics?

Transport assay methodologies:

  • Reconstituted proteoliposome assays:

    • Purified SapB (with partner proteins) reconstituted in liposomes

    • Radiolabeled or fluorescently labeled peptide substrates

    • Time-course measurement of substrate uptake

    • Inhibitor competition studies

  • Whole-cell transport assays:

    • Comparison of peptide uptake in wild-type vs. ΔsapB strains

    • Use of non-metabolizable peptide analogs

    • Competition with excess unlabeled substrates

    • Measurement using scintillation counting or fluorescence

  • Electrophysiological methods:

    • Patch-clamp analysis of reconstituted transporters

    • Solid-supported membrane electrophysiology

    • Black lipid membrane recordings

  • Biophysical interaction studies:

    • Surface plasmon resonance for substrate binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for binding affinity determination

Data analysis should include:

  • Determination of Km and Vmax parameters

  • Substrate specificity profiles

  • Energy coupling mechanisms

  • Effects of pH, temperature, and ionic conditions

These methodologies provide complementary information about transport mechanisms and should be used in combination for comprehensive characterization.

How might SapB function in the context of recombinant attenuated Salmonella vaccine (RASV) development?

The potential role of SapB in RASV platforms represents an intriguing research direction, building on established work with Salmonella-based vaccines. Current research demonstrates that Salmonella strains can effectively deliver heterologous antigens, as seen in studies with S. Typhi vaccines expressing Streptococcus pneumoniae surface protein PspA .

Potential research approaches:

  • SapB as an antigen delivery system:

    • Construction of SapB-antigen fusion proteins

    • Evaluation of membrane localization and exposure

    • Assessment of immune response to SapB-delivered antigens

  • SapB mutation effects on vaccine strain properties:

    • Analysis of sapB deletion on bacterial fitness and persistence

    • Evaluation of sapB mutation on immunogenicity

    • Measurement of antigen-specific immune responses

  • Comparative studies with other mutations:

    • Similar to research on sopB deletion mutations, which enhanced immunogenicity and protective efficacy of recombinant attenuated Salmonella vaccines expressing PspA

    • Analysis of combination mutations including sapB

Research has demonstrated that specific mutations in Salmonella can significantly alter vaccine properties. For example, sopB deletion mutants showed increased immunogenicity compared to isogenic sopB+ strains, inducing higher levels of antigen-specific serum IgG and mucosal IgA . Similar comparative studies with sapB mutations could reveal important vaccine strain optimizations.

What immunological parameters should be measured when evaluating SapB-modified Salmonella vaccine vectors?

When assessing SapB-modified vaccine vectors, researchers should employ a comprehensive immunological evaluation framework:

Antibody responses measurement:

  • Antigen-specific serum IgG (total and subclasses)

  • Mucosal IgA in intestinal lavage, fecal, and bronchial samples

  • Antibody avidity maturation

  • Neutralizing antibody titers where applicable

Cellular immune response analysis:

  • T cell responses by ELISpot (IFN-γ, IL-4, IL-17)

  • Flow cytometry for T cell subset activation (CD4+, CD8+)

  • Memory T cell generation (CD4+CD44hiCD62Lhi and CD8+CD44hiCD62Lhi)

  • Cytokine profiling in culture supernatants

Protection studies:

  • Challenge with virulent pathogen strains

  • Measurement of bacterial/viral loads

  • Survival rate analysis

  • Pathology scoring

In recombinant attenuated Salmonella vaccine studies, researchers found that RpoS+ vaccines induced a balanced Th1/Th2 immune response, while certain RpoS- strains induced a strong Th2 immune response . Similar immunological profiling would be valuable for understanding the impact of SapB modifications on vaccine efficacy.

How does SapB compare with other Salmonella proteins as targets for attenuating mutations in vaccine development?

Comparative analysis of different Salmonella proteins as mutation targets provides important insights for rational vaccine design:

ProteinFunctionEffect of Mutation on Vaccine PropertiesImmune Response CharacteristicsProtection Level
SopBInositol phosphate phosphataseEnhanced immunogenicity, reduced reactogenicityIncreased IgG and IgA, enhanced T cell memorySignificantly improved
RpoSSigma factorAltered Th1/Th2 balanceRpoS+ induces balanced response, RpoS- stronger Th2Variable by strain
SapBPeptide transport permeaseRequires investigationHypothesized altered antigen presentationRequires investigation
PhoP/PhoQTwo-component regulatorReduced virulence, maintained immunogenicityEnhanced cellular responsesGood
AroAAromatic biosynthesisMetabolic attenuationReduced persistence, moderate immunogenicityModerate

Research on sopB mutants demonstrated higher interleukin-4 and gamma interferon secretion levels and increased numbers of CD4+CD44hiCD62Lhi and CD8+CD44hiCD62Lhi central memory T cells compared to isogenic sopB+ strains . Similar comprehensive immunological profiling for sapB mutants would enable rational comparison across different attenuation strategies.

When designing comparative studies, researchers should standardize:

  • Antigen expression levels

  • Vaccination protocols

  • Challenge models

  • Immune analysis methods

This standardization is critical for valid comparisons between different mutation strategies.

What techniques are optimal for studying protein-protein interactions involving SapB in the transport complex?

Understanding SapB interactions within its transport complex requires multiple complementary approaches:

In vitro interaction studies:

  • Co-immunoprecipitation with tagged SapB

  • Pull-down assays with purified components

  • Surface plasmon resonance for binding kinetics

  • Isothermal titration calorimetry for thermodynamic parameters

  • Crosslinking followed by mass spectrometry (XL-MS)

In vivo interaction analysis:

  • Bacterial two-hybrid systems

  • Fluorescence resonance energy transfer (FRET)

  • Split-GFP complementation assays

  • Co-localization by immunofluorescence microscopy

  • In vivo crosslinking followed by co-purification

Structural approaches:

  • X-ray crystallography of the complete complex

  • Cryo-electron microscopy for large assemblies

  • Nuclear magnetic resonance for dynamic interactions

  • Hydrogen-deuterium exchange mass spectrometry

  • Small-angle X-ray scattering for solution structure

These methodologies provide complementary information about the spatial arrangement, binding affinities, and dynamics of the transport complex components. The integration of multiple approaches is necessary for a comprehensive understanding of SapB function within its native complex.

How can researchers investigate the regulatory mechanisms controlling SapB expression and function?

Investigating SapB regulation requires multi-level analysis of transcriptional, translational, and post-translational control mechanisms:

Transcriptional regulation studies:

  • Promoter mapping using 5' RACE

  • Promoter-reporter fusions with progressive deletions

  • Chromatin immunoprecipitation to identify regulatory proteins

  • In vitro DNA-protein binding assays (EMSA, DNase footprinting)

  • Global transcription factor screening

Translational regulation analysis:

  • mRNA structure analysis (SHAPE, inline probing)

  • Ribosome profiling to assess translation efficiency

  • RNA-protein interaction studies (RNA-IP, CLIP-seq)

  • Translation reporter assays

Post-translational regulation investigation:

  • Phosphorylation site mapping by mass spectrometry

  • Protein stability assays with translation inhibitors

  • Membrane localization studies with fluorescent fusions

  • Transport activity assays under various conditions

Research on the streptomycete morphogenetic peptide SapB demonstrates the importance of multi-tier regulation, including transcriptional control and post-translational modification . Similar complex regulation might exist for the Salmonella SapB transport protein, potentially involving membrane localization as a regulatory mechanism, as observed with other bacterial membrane proteins.

What bioinformatic approaches are valuable for analyzing SapB structure and predicting functional domains?

Computational analysis provides important insights into SapB structure and function:

Sequence-based analysis:

  • Multiple sequence alignment with homologs

  • Conservation analysis to identify functional residues

  • Transmembrane topology prediction (TMHMM, Phobius)

  • Signal peptide and membrane protein sorting signals

  • Functional domain identification

Structural prediction methods:

  • Homology modeling based on related transporters

  • Ab initio structure prediction using AlphaFold2

  • Molecular dynamics simulations in membrane environment

  • Protein-peptide docking for substrate binding prediction

  • Electrostatic surface potential analysis

Systems biology integration:

  • Gene neighborhood analysis across bacterial species

  • Co-expression network analysis

  • Protein-protein interaction network prediction

  • Pathway enrichment analysis

  • Cross-species functional annotation transfer

These computational approaches generate testable hypotheses about SapB function and provide frameworks for interpreting experimental results. The integration of bioinformatic predictions with experimental validation creates a powerful iterative approach to understanding SapB biology.

What are common challenges in expressing and purifying recombinant SapB, and how can they be addressed?

Membrane proteins like SapB present specific technical challenges that require specialized approaches:

Challenge: Toxicity to expression host

  • Solution: Use tightly regulated expression systems (pBAD, tet-inducible)

  • Solution: Employ specialized strains (C41/C43, Lemo21)

  • Solution: Consider cell-free expression systems

Challenge: Formation of inclusion bodies

  • Solution: Lower induction temperature (16-20°C)

  • Solution: Reduce inducer concentration

  • Solution: Co-express with chaperones (GroEL/ES, DnaK/J)

  • Solution: Express with solubility-enhancing fusion partners

Challenge: Poor extraction efficiency

  • Solution: Screen multiple detergents systematically

  • Solution: Optimize detergent:protein ratio

  • Solution: Use styrene-maleic acid copolymer (SMA) extraction

  • Solution: Consider nanodiscs or amphipols for stabilization

Challenge: Loss of function during purification

  • Solution: Include stabilizing ligands throughout purification

  • Solution: Maintain critical lipids in purification buffers

  • Solution: Minimize time between extraction and reconstitution

  • Solution: Validate function at each purification step

Challenge: Low yield of functional protein

  • Solution: Scale up culture volume

  • Solution: Optimize media composition for membrane protein expression

  • Solution: Consider bioreactor cultivation with controlled oxygen levels

  • Solution: Implement high-throughput screening for optimal conditions

Systematic troubleshooting with carefully designed controls at each step is essential for successful membrane protein research.

How can researchers distinguish between direct and indirect effects when studying SapB knockout phenotypes?

Distinguishing direct from indirect effects requires rigorous experimental design:

Complementation strategies:

  • Expression of wild-type SapB from plasmid or chromosomal integration

  • Expression of SapB point mutants affecting specific functions

  • Expression of homologous transporters from related bacteria

  • Controlled expression using inducible promoters

Targeted functional assays:

  • Direct measurement of peptide transport in isolated membrane vesicles

  • In vitro reconstitution with purified components

  • Substrate binding assays with isolated SapB

  • Site-specific reporter insertion to monitor conformational changes

Temporal analysis approaches:

  • Time-course studies to identify primary vs. secondary effects

  • Inducible knockout systems for acute vs. chronic loss

  • Pulse-chase labeling to track metabolic consequences

  • Single-cell analysis to capture heterogeneous responses

Genetic interaction mapping:

  • Synthetic genetic array analysis

  • Suppressor mutation screening

  • Double-knockout studies with related transporters

  • Chemical genetic profiling

These approaches help separate direct transport defects from downstream physiological adaptations. For example, when studying sopB mutation effects on Salmonella vaccine strains, researchers needed to distinguish direct immunological effects from indirect consequences on bacterial colonization and persistence .

What emerging technologies might advance our understanding of SapB function in Salmonella?

Several cutting-edge methodologies show promise for deepening our understanding of SapB biology:

Advanced structural biology approaches:

  • Cryo-electron tomography of SapB in native membranes

  • Time-resolved structural studies using X-ray free-electron lasers

  • Single-molecule FRET to capture conformational dynamics

  • Integrative structural biology combining multiple data types

Single-cell technologies:

  • Single-cell RNA-seq to capture heterogeneous responses

  • Microfluidic platforms for real-time transport measurements

  • Super-resolution microscopy for spatial organization

  • Mass cytometry for multiplexed protein detection

Genome engineering advances:

  • CRISPR interference for tunable gene repression

  • Base editing for precise point mutations

  • Prime editing for versatile genetic modifications

  • Optogenetic control of SapB expression or function

Systems biology integration:

  • Multi-omics profiling of sapB mutants

  • Metabolic flux analysis to quantify physiological impacts

  • Machine learning for pattern recognition in complex datasets

  • Whole-cell modeling incorporating transport kinetics

These emerging technologies promise to reveal new aspects of SapB function and regulation within the complex bacterial physiology of Salmonella.

How might understanding SapB function contribute to developing novel antimicrobial strategies?

Research on bacterial transport systems like SapB may inform new antimicrobial approaches:

Potential antimicrobial strategies:

  • Direct inhibition of SapB transport function

  • Exploitation of SapB as an entry point for antimicrobial conjugates

  • Targeting SapB-dependent physiological processes

  • Vaccine approaches incorporating SapB epitopes

Research approaches needed:

  • High-throughput screening for SapB inhibitors

  • Structure-based drug design targeting critical residues

  • Peptidomimetic development to compete with natural substrates

  • Assessment of SapB conservation across Salmonella strains

Resistance development considerations:

  • Frequency of resistance mutation emergence

  • Fitness costs of resistance mechanisms

  • Cross-resistance to other antimicrobial compounds

  • Compensatory mechanisms bypassing SapB function

Understanding transport systems has previously yielded successful antimicrobial strategies, and detailed characterization of SapB may similarly reveal exploitable vulnerabilities in Salmonella.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.