Recombinant Salmonella typhimurium Phosphoethanolamine transferase CptA (cptA)

What is Phosphoethanolamine transferase CptA and what is its role in Salmonella typhimurium?

Phosphoethanolamine transferase CptA (encoded by the cptA gene, also known as STM4118) is an integral membrane protein in Salmonella typhimurium that catalyzes the addition of phosphoethanolamine (pEtN) groups to the core oligosaccharide portion of lipopolysaccharide (LPS) . The protein consists of 577 amino acids and functions as part of the bacterial system for modifying cell surface structures . CptA belongs to a family of phosphoethanolamine transferases with homology to similar enzymes in other bacterial species, including Neisseria meningitidis Lpt-3 and LptA .

The enzyme is specifically regulated by the PmrA-PmrB two-component regulatory system, which responds to environmental cues such as mild acid pH and high iron concentrations . These modifications to the LPS structure can alter the bacterial membrane's properties, potentially affecting interactions with host antimicrobial peptides and contributing to pathogenicity mechanisms.

How does CptA differ from other LPS-modifying enzymes in Salmonella?

CptA has a distinct function from other LPS-modifying enzymes in Salmonella, particularly PmrC:

• Substrate specificity: While CptA specifically catalyzes the addition of phosphoethanolamine to the LPS core, PmrC transfers phosphoethanolamine to the 1-phosphate position of lipid A (the innermost portion of LPS) .

• Genetic independence: Mutations in pmrC do not affect core pEtN addition (CptA's function), and mutations in cptA do not affect lipid A pEtN addition (PmrC's function), confirming their distinct roles .

• Evolutionary relationships: CptA shows homology to phosphoethanolamine transferases from other bacterial species, particularly those from Neisseria meningitidis, while having distinct evolutionary origins from PmrC .

• Contribution to resistance: Unlike modifications by enzymes that add 4-aminoarabinose (Ara4N) to LPS, which significantly enhance polymyxin B resistance and affect murine virulence, the phosphoethanolamine additions by CptA have more subtle effects on antimicrobial peptide resistance .

What is the genomic context of the cptA gene in Salmonella typhimurium?

The cptA gene (STM4118) is located in the Salmonella typhimurium genome and encodes a 577-amino acid protein . It is part of the regulatory network controlled by the PmrA-PmrB two-component system . The gene shows homology to phosphoethanolamine transferases from other bacterial species and exists within the broader genomic landscape of Salmonella .

According to comprehensive genomic analysis across multiple Salmonella strains, genes like cptA can exist within regions of genomic plasticity that vary between different serovars and strains . These regions play essential roles in shaping the pathogenicity of various Salmonella lineages and contribute to their evolutionary adaptation . The placement of genes like cptA within these regions may be influenced by conserved flanking genes that likely share regulatory and functional coordination .

How is CptA expression regulated in Salmonella?

CptA expression in Salmonella typhimurium is primarily regulated by the PmrA-PmrB two-component regulatory system, which responds to specific environmental cues . This regulation occurs through several mechanisms:

• Direct activation: The PmrA-PmrB system can be activated in response to mild acid pH or high iron concentrations, environmental conditions that bacteria might encounter during host infection . When activated, phosphorylated PmrA binds to the promoter region of cptA and induces its transcription.

• Indirect activation: PmrA-PmrB can also be activated indirectly through the PhoP-PhoQ system, another two-component regulatory system that responds to low magnesium or low pH conditions . This cross-regulation occurs via the connector protein PmrD, which affects the phosphorylation state of PmrA .

• Integration with bacterial defense systems: Expression of CptA is part of a coordinated response that includes other LPS modifications, allowing Salmonella to adapt its outer membrane structure in response to environmental threats .

This complex regulatory network ensures that lipopolysaccharide modifications, including those mediated by CptA, occur under appropriate conditions during infection processes and environmental adaptation .

What experimental approaches are most effective for studying CptA function in vitro?

To effectively study CptA function in vitro, researchers should consider a multi-faceted approach combining genetic, biochemical, and structural methods:

Genetic manipulation techniques:

• Lambda Red recombinase and FLP-mediated recombination are effective for generating precise mutations in cptA .

• This approach involves PCR amplification of a kanamycin resistance fragment with primers flanked by homology to cptA, followed by transformation into strains expressing lambda Red recombinase .

• Verification of correct gene disruption can be performed by PCR using primers flanking the expected integration site .

LPS analysis methods:

• Extraction of LPS using the hot phenol-water method, followed by analysis via deoxycholine-polyacrylamide gel electrophoresis (DOC-PAGE) and silver staining provides visual confirmation of phosphoethanolamine modifications .

• For DOC-PAGE analysis, LPS samples should be dissolved at a concentration of 4 μg/μl, with 1 μl loaded per well and electrophoresed at 30 mA constant current .

• Silver staining development allows visualization of characteristic shifts in LPS migration patterns when pEtN is added to the core oligosaccharide .

Recombinant protein approaches:

• Expression of the full-length CptA protein (amino acids 1-577) with appropriate tags for purification and activity assays .

• Optimal storage in Tris-based buffer with 50% glycerol at -20°C or -80°C, avoiding repeated freeze-thaw cycles .

• For working with the protein, maintain aliquots at 4°C for up to one week .

Assay characterization:

• Development of response curves using multipoint serial dilutions to establish lower limit of quantification (LLOQ), limit of detection (LOD), and linear range for quantitative assessments .

• Assessment of intra-assay reproducibility through multiple measurements at different protein concentrations .

How can mutations in cptA be generated and characterized in Salmonella?

Generating and characterizing mutations in cptA requires a systematic approach that ensures specificity and verifiable outcomes:

Mutation generation methodology:

• The lambda Red recombinase system developed by Datsenko and Wanner provides an efficient approach for targeted gene disruption .

• Design primers with 40-bp homology to regions flanking cptA and 20-bp homology to a selectable marker (e.g., kanamycin resistance cassette) .

• PCR amplify the resistance marker using these primers and transform the product into Salmonella strains expressing lambda Red recombinase from pKD46 .

• Select recombinants on appropriate antibiotic media and verify correct integration .

Verification strategies:

• PCR verification using primers that flank the expected integration site to confirm correct insertion size .

• Phenotypic confirmation through analysis of LPS modifications using DOC-PAGE to visualize changes in LPS migration patterns .

• Complementation studies by expressing wild-type cptA in trans from a plasmid in the mutant strain to confirm that observed phenotypes are specifically due to the cptA mutation.

Functional characterization approaches:

• Comparison of LPS profiles between wild-type, mutant, and complemented strains using DOC-PAGE and silver staining .

• Assessment of antimicrobial peptide sensitivity using minimum inhibitory concentration (MIC) assays with various antimicrobial compounds.

• Virulence assessment in appropriate animal models, including competition assays between wild-type and mutant strains .

Creating marker-free mutations:

• After verification, the antibiotic resistance marker can be removed using FLP recombinase expressed from pCP20, leaving a minimal scar sequence and allowing for subsequent genetic manipulations .

What is the biochemical mechanism of phosphoethanolamine transfer by CptA?

The biochemical mechanism of phosphoethanolamine transfer by CptA involves several coordinated steps:

Catalytic mechanism:

• CptA likely functions as a metal-dependent phosphotransferase based on sequence homology to other characterized enzymes in this family .

• The enzyme catalyzes the transfer of a phosphoethanolamine group from a donor substrate (likely phosphatidylethanolamine or a related phospholipid) to specific positions on the LPS core oligosaccharide.

• The reaction likely proceeds through a nucleophilic attack mechanism with possible formation of a covalent enzyme-substrate intermediate during the transfer process.

Key structural features involved in catalysis:

• Analysis of the CptA amino acid sequence reveals multiple transmembrane domains that anchor the protein in the bacterial membrane, positioning the catalytic domain appropriately relative to the LPS substrate .

• The region "LVIGESTQRGRMSLYGYPRETTPELDALHK" within the protein sequence contains residues likely involved in catalysis based on homology to other transferases .

• Conserved residues among phosphoethanolamine transferases include essential catalytic amino acids responsible for coordination of metal cofactors and substrate binding.

Substrate specificity determinants:

• CptA demonstrates remarkable specificity for the core oligosaccharide portion of LPS rather than lipid A, distinguishing it from PmrC .

• This specificity likely derives from unique structural features within the CptA protein that recognize specific chemical structures within the LPS core.

How does CptA contribute to antimicrobial resistance in Salmonella?

The contribution of CptA to antimicrobial resistance in Salmonella involves complex membrane modifications that affect interactions with host defense molecules:

Mechanism of resistance modification:

• Phosphoethanolamine addition by CptA introduces alterations to the charge distribution of the LPS core oligosaccharide .

• These modifications can affect the electrostatic interactions between cationic antimicrobial peptides and the bacterial outer membrane.

• The altered surface properties may prevent antimicrobial peptides from efficiently inserting into and disrupting the membrane.

Comparative resistance profile:

• Unlike 4-aminoarabinose (Ara4N) modifications, which significantly enhance polymyxin B resistance and affect murine virulence, the phosphoethanolamine additions by CptA have more subtle effects on antimicrobial peptide resistance .

• Research suggests that mutations in cptA do not significantly alter polymyxin B susceptibility compared to wild-type strains, indicating that this specific modification may serve purposes beyond simple antimicrobial peptide resistance .

Integrated defense mechanisms:

• CptA modifications likely work in concert with other LPS modifications (such as those mediated by PmrC and the Ara4N addition system) to create a comprehensive defense against various antimicrobial compounds.

• The combined effect of multiple modifications may create a synergistic protective effect not observed with individual modifications alone.

What methods can be used to assay CptA enzymatic activity?

Several complementary methods can be employed to assess CptA enzymatic activity:

Direct biochemical assays:

• In vitro transferase activity assays using purified recombinant CptA , appropriate phosphoethanolamine donors, and isolated LPS core oligosaccharide substrates.

• Mass spectrometry analysis to directly detect the addition of phosphoethanolamine groups to LPS core structures, providing precise molecular confirmation of enzyme activity.

• Enzyme kinetics studies to determine Km and Vmax values for both phosphoethanolamine donor and LPS acceptor substrates.

Indirect functional approaches:

• Electrophoretic mobility shift assays of LPS using DOC-PAGE to detect changes in migration patterns due to phosphoethanolamine addition .

• Comparison of LPS profiles between wild-type, cptA mutant, and complemented strains provides evidence of enzymatic activity in vivo .

Assay optimization parameters:

• Development of response curves through multipoint serial dilution experiments to establish assay performance parameters including lower limit of quantification (LLOQ) and limit of detection (LOD) .

• Assessment of intra-assay reproducibility at each concentration point to determine the reliability of activity measurements .

• Calibration using known standards to ensure accurate quantification of enzymatic activity.

How does CptA function in the context of Salmonella virulence in animal models?

Understanding CptA's role in Salmonella virulence requires carefully designed animal studies:

Mouse infection methodology:

• Oral infection models using BALB/c mice provide a physiologically relevant system for studying CptA's contribution to virulence .

• Typically, approximately 5 × 10^6 stationary-phase bacteria (1 log unit above the 50% lethal dose) are administered orally using the swallowing reflex or with a feeding needle .

• Infected mice should be observed for extended periods (21+ days) to capture both acute and chronic infection dynamics .

Competition assay approach:

• Competition assays using a 1:1 ratio of wild-type to mutant bacteria (1 × 10^6 of each) can reveal subtle fitness differences in vivo that might not be apparent in single-strain infections .

• At defined time points post-infection (e.g., 4 days), organs should be harvested, macerated, and plated onto appropriate selective media to determine the relative abundance of each strain .

• The competitive index (ratio of mutant to wild-type bacteria recovered from infected tissues, normalized to the input ratio) provides a quantitative measure of in vivo fitness.

Experimental findings:

• Individual cptA mutations alone do not significantly alter virulence compared to wild-type strains in mouse models, unlike mutations affecting Ara4N addition to LPS .

• This suggests that while CptA contributes to LPS modification, its specific contribution to virulence may be context-dependent or partially redundant with other mechanisms.

Combined mutation analysis:

• Studies with strains carrying mutations in multiple LPS modification genes (cptA, pmrC, etc.) could reveal functional redundancy or synergistic effects that may not be apparent with single mutations.