Recombinant Salmonella typhimurium Phosphoethanolamine transferase eptB (eptB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant eptB is produced via heterologous expression in Escherichia coli and purified to >90% purity by SDS-PAGE . Key structural and biochemical properties include:

PropertyDetails
Protein LengthFull-length (1–563 amino acids)
TagN-terminal His-tag
Molecular Weight~63 kDa (calculated from amino acid sequence)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with optional glycerol (5–50%)

The enzyme’s primary function involves transferring phosphoethanolamine (pEtN) to lipid A, a core component of lipopolysaccharide (LPS) . This modification alters LPS structure, influencing bacterial virulence and immune recognition.

Functional Role in Lipid A Modification

EptB catalyzes the addition of pEtN to lipid A at the 7''-position, a critical step in modulating bacterial outer membrane charge and immune interactions .

Key Functional Insights

  • Immune Evasion: In Salmonella Typhimurium, eptB-mediated lipid A modification prevents binding of intelectin, a host antimicrobial protein. Loss of eptB function allows intelectin to detoxify LPS, reducing systemic inflammation .

  • LPS Structure: The pEtN modification reduces the negative charge on lipid A, potentially enhancing bacterial resistance to cationic antimicrobial peptides (e.g., colistin) .

  • Species-Specific Activity: Salmonella Typhimurium eptB differs from Escherichia coli eptB in lipid A modification efficiency, attributed to structural variations in the enzyme’s catalytic domain .

Research Applications

Recombinant eptB is pivotal in studying bacterial pathogenesis and antimicrobial resistance.

Experimental Use Cases

ApplicationMethodologyOutcome
LPS Binding AssaysDot blot/ELISA with intelectin or antimicrobial peptidesDemonstrated reduced intelectin binding in eptB-deficient S. Typhimurium
Mouse Infection ModelsOral gavage with eptB mutant vs. wild-type S. TyphimuriumLower systemic inflammation (e.g., reduced TNF-α in spleen) in eptB mutants
Antimicrobial ResistanceqPCR analysis of eptB expression under colistin stressEnhanced eptB expression in E. coli harboring mcr-1 under sub-inhibitory colistin

Antimicrobial Resistance Implications

EptB’s role in lipid A modification intersects with resistance mechanisms against colistin, a last-resort antibiotic.

MechanismEvidence
Colistin ResistanceOverexpression of eptB enhances lipid A pEtN addition, reducing colistin binding
mcr Gene Synergymcr-1 plasmid-mediated resistance correlates with elevated eptB expression in E. coli
EDTA SensitivityStrains expressing eptB show increased sensitivity to EDTA-mediated ion depletion

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
eptB; STM3635; Kdo(2-lipid A phosphoethanolamine 7''-transferase; Phosphoethanolamine transferase EptB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-563
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
eptB
Target Protein Sequence
MRYIKSMTQQKLSFLLALYIGLFMNCAVFYRRFGSYAQEFTIWKGLSAVVELGATVLVTF FLLRLLSLFGRRVWRVLATLVVLFSAGASYYMTFLNVVIGYGIIASVMTTDIDLSKEVVG LHFVLWLIAVSVLPLIFIWSNHCRYTLLRQLRTPGQRFRSAAVVVLAGVMVWAPIRLLDI QQKKVERATGIDLPSYGGVVANSYLPSNWLSALGLYAWAQVDESSDNNSLINPARKFTYV APKDGDDTYVVFIIGETTRWDHMGIFGYERNTTPKLAQEKNLAAFRGYSCDTATKLSLRC MFVREGGADNNPQRTLKEQNVFAVLKQLGFSSDLYAMQSEMWFYSNTMADNISYREQIGA EPRNRGKTVDDMLLIDEMQNSLAQNPEGKHLIILHTKGSHFNYTQRYPRSYAQWKPECIG VDSGCTKAQMINSYDNSVTYVDHFITSVFDQLRDKKAIVFYAADHGESINEREHLHGTPR NMAPPEQFRVPMLVWMSDKYLASPQHAQMFAHLKQQAEIKVPRRHVELYDTIMGCLGYTS PNGGINQNNNWCHIPDVQKVAAK
Uniprot No.

Target Background

Function
Catalyzes the addition of a phosphoethanolamine (pEtN) moiety to the outer 3-deoxy-D-manno-octulosonic acid (Kdo) residue of a Kdo(2)-lipid A. Phosphatidylethanolamines with one unsaturated acyl group function as pEtN donors, and the reaction releases diacylglycerol.
Database Links

KEGG: stm:STM3635

STRING: 99287.STM3635

Protein Families
Phosphoethanolamine transferase family, EptB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of phosphoethanolamine transferase eptB in Salmonella typhimurium?

Phosphoethanolamine transferase eptB is an enzyme that modifies lipopolysaccharide (LPS) structure in Salmonella typhimurium by adding phosphoethanolamine groups to specific positions on the LPS molecule . This modification affects how the bacterial surface interacts with host immune components, particularly intelectin, a protein involved in innate immunity . Functional eptB in S. typhimurium prevents intelectin binding to LPS, which enables the bacterium to trigger stronger inflammatory responses during infection .

To study this function, researchers can employ gene knockout techniques to create eptB mutants, followed by structural analysis of LPS using mass spectrometry and chromatography methods. Comparative studies between wild-type and mutant strains can reveal specific alterations in LPS architecture and consequent changes in host-pathogen interactions.

How does eptB expression differ between Salmonella typhimurium and Salmonella typhi?

While S. typhimurium possesses a functional eptB gene, S. typhi lacks functional eptB expression . This differential expression contributes to the distinct pathogenesis patterns observed between these Salmonella serovars . The absence of functional eptB in S. typhi allows intelectin to bind to and potentially detoxify its LPS, resulting in reduced inflammatory responses compared to S. typhimurium infections .

To methodologically investigate this difference, researchers should implement comparative genomics approaches, quantitative PCR to measure expression levels, and complementation studies where the functional eptB gene is introduced into S. typhi to observe phenotypic changes. Western blotting with anti-eptB antibodies can also confirm the presence or absence of the protein in different serovars.

What are the optimal methods for generating recombinant eptB for in vitro studies?

For producing recombinant eptB protein, a multistep approach is recommended:

  • Gene amplification: PCR-amplify the eptB gene from S. typhimurium genomic DNA using high-fidelity polymerase

  • Expression vector selection: Clone the gene into an appropriate vector (pET series for E. coli expression systems)

  • Expression conditions: Optimize expression in E. coli BL21(DE3) or similar strains, testing various induction parameters (IPTG concentration, temperature, induction time)

  • Purification strategy: Implement immobilized metal affinity chromatography (IMAC) with a histidine tag, followed by size exclusion chromatography

  • Activity verification: Develop an enzymatic assay to confirm phosphoethanolamine transferase activity using synthetic LPS substrates

The recombinant protein should be characterized by mass spectrometry, circular dichroism spectroscopy, and thermal shift assays to confirm proper folding and stability before use in functional studies.

How can researchers effectively create and validate eptB knockout mutants in Salmonella?

To generate eptB knockout mutants, researchers can employ these methodological approaches:

  • Lambda Red recombination system: Replace the eptB gene with an antibiotic resistance cassette

  • CRISPR-Cas9 gene editing: Create precise deletions or mutations in the eptB gene

  • Verification steps:

    • PCR confirmation of gene deletion

    • Whole genome sequencing to ensure no off-target effects

    • Complementation studies to restore the wild-type phenotype

    • LPS structural analysis to confirm alterations in phosphoethanolamine modification

Validation experiments should include:

  • Growth curve analysis to assess fitness costs

  • In vitro LPS binding assays with recombinant intelectin

  • Cytokine induction assays with macrophages or epithelial cells

What infection models are most appropriate for studying eptB's role in Salmonella pathogenesis?

Model SystemAdvantagesLimitationsReadouts
C57BL/6 miceMimics systemic infection, accessible immune markersLimited intestinal diseaseCytokine levels, bacterial burden, mortality
Cell culture (macrophages)Controlled conditions, mechanistic studiesLacks complex immune interactionsBacterial survival, cytokine production, signaling pathways
OrganoidsMaintains tissue architecture, species-specific responsesTechnical complexity, variabilityBacterial invasion, tissue damage, epithelial responses
Zebrafish larvaeTransparent, allows real-time imagingEvolutionary distance from humansNeutrophil recruitment, bacterial dissemination

For studying eptB's role in inflammatory modulation, the C57BL/6 mouse model allows measurement of cytokine expression in tissues like spleen, liver, and Peyer's patches using qPCR techniques . Bacterial burden should be quantified by tissue homogenization and plating on selective media, while histopathological examination provides insights into tissue inflammation levels.

How does the loss of eptB function alter host-pathogen recognition and inflammatory pathways?

The loss of eptB function in S. typhimurium creates a phenotype that more closely resembles S. typhi in terms of immune evasion . This alteration occurs through multiple mechanisms:

  • Intelectin binding: Without functional eptB, intelectin can bind to Salmonella LPS, potentially neutralizing or detoxifying it

  • Inflammatory signaling: Modified LPS structure changes interactions with pattern recognition receptors like TLR4

  • Cytokine modulation: eptB mutants induce reduced expression of inflammatory cytokines in infected tissues, as demonstrated in mouse models

To study these pathways, researchers should employ:

  • Phosphoproteomic analysis to track signaling cascade alterations

  • RNA-seq of infected tissues to identify differentially expressed inflammatory genes

  • Flow cytometry to characterize immune cell recruitment and activation

  • CRISPR screens in host cells to identify critical recognition pathways

What is the molecular mechanism by which intelectin interacts with LPS from eptB-deficient Salmonella?

The molecular interaction between intelectin and LPS from eptB-deficient bacteria involves specific recognition of LPS structural elements that are normally masked or modified by eptB activity . To elucidate this mechanism:

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM of intelectin-LPS complexes

    • NMR spectroscopy to identify binding interfaces

    • Surface plasmon resonance to quantify binding kinetics

  • Mutagenesis studies:

    • Alanine scanning of intelectin to identify critical residues

    • Synthetic LPS variants with different phosphoethanolamine modifications

  • Molecular dynamics simulations to model the interaction energetics and conformational changes

This interaction is crucial for understanding how S. typhi naturally evades robust inflammatory responses and how this mechanism might be exploited for therapeutic development.

How can the eptB-intelectin interaction pathway inform the development of novel antimicrobial strategies?

The eptB-intelectin interaction represents a potential target for novel antimicrobial approaches . Research methodologies should include:

  • Drug discovery pipeline:

    • High-throughput screening for eptB inhibitors

    • Structure-based design of compounds that mimic intelectin binding

    • Repurposing screens of FDA-approved compounds

  • Validation methods:

    • In vitro enzyme inhibition assays

    • Cell-based infection models with cytokine readouts

    • Animal infection models measuring bacterial burden and inflammation

  • Combination therapy approaches:

    • Testing eptB inhibitors with conventional antibiotics

    • Evaluating synergy with host-directed immunomodulatory agents

By targeting eptB activity, it may be possible to convert virulent S. typhimurium into a less inflammatory phenotype, potentially reducing disease severity while maintaining immune recognition for clearance .

What statistical approaches are most appropriate for analyzing inflammatory responses in eptB research?

When analyzing inflammatory responses in eptB research, several statistical approaches are recommended:

  • For cytokine expression data (qPCR):

    • Normalization to reference genes using the 2^(-ΔΔCt) method

    • Log transformation of cytokine values to achieve normal distribution

    • ANOVA with post-hoc tests for multi-group comparisons (wild-type, eptB mutant, complemented strain)

  • For bacterial burden data:

    • Non-parametric tests (Mann-Whitney) for CFU counts that often show non-normal distribution

    • Time-series analysis for longitudinal infection studies

  • For multivariate datasets:

    • Principal component analysis to identify patterns in host response

    • Machine learning approaches to identify predictive biomarkers of infection outcome

Statistical power calculations should be performed prior to experiments, with appropriate sample sizes to detect biologically relevant differences in inflammatory markers between wild-type and eptB mutant infections.

How should researchers address contradictory findings regarding eptB's role in different experimental systems?

Contradictory findings in eptB research may arise from differences in experimental systems. A systematic approach to resolving these contradictions includes:

  • Standardization of methodologies:

    • Create detailed protocols for bacterial strain preparation and growth conditions

    • Establish consistent infection parameters (MOI, time points, sample collection)

    • Use identical readout systems across laboratories

  • Cross-validation strategies:

    • Employ multiple experimental models (different cell lines, animal models)

    • Utilize complementary readout systems (ELISA, qPCR, flow cytometry)

    • Perform independent replications in different laboratories

  • Meta-analysis framework:

    • Systematic review of existing literature with quality assessment

    • Statistical pooling of comparable datasets

    • Identification of variables that explain interstudy variability

When contradictions arise, researchers should consider genetic differences in bacterial strains, host genetic background effects, and microbiome influences that may modify eptB-dependent inflammatory responses.

How might high-throughput screening approaches identify novel inhibitors of eptB function?

A comprehensive high-throughput screening strategy for eptB inhibitors should include:

  • Assay development:

    • Fluorescence-based enzymatic assays using synthetic LPS substrates

    • Cell-based reporter systems that monitor inflammatory pathway activation

    • Phenotypic screens measuring intelectin binding to bacterial surfaces

  • Compound libraries to screen:

    • Natural product extracts, particularly from sources known to have anti-inflammatory properties

    • Synthetic chemical libraries focusing on compounds that target bacterial enzymes

    • Peptide libraries designed to mimic intelectin binding domains

  • Validation pipeline:

    • Secondary assays to confirm target engagement

    • Structure-activity relationship studies

    • In vivo efficacy testing in infection models

    • Toxicity and pharmacokinetic profiling

This approach could yield novel therapeutic agents that modulate bacterial virulence rather than growth, potentially reducing selection pressure for resistance.

What are the implications of eptB research for understanding chronic Salmonella typhi carriage?

The eptB research has significant implications for understanding chronic S. typhi carriage :

  • Research methodologies to explore this connection:

    • Development of humanized mouse models to study S. typhi persistence

    • Long-term infection studies with eptB-complemented S. typhi strains

    • Tissue-specific analysis of bacterial adaptation during chronic infection

  • Key hypotheses to test:

    • Whether intelectin-LPS interactions facilitate S. typhi persistence in gallbladder tissue

    • If eptB expression is dynamically regulated during different infection phases

    • Whether host genetic variants in intelectin affect susceptibility to chronic carriage

  • Clinical correlations:

    • Analysis of eptB sequence variants in clinical isolates from chronic carriers

    • Immunological profiling of chronic carriers for intelectin expression and function

    • Longitudinal studies of inflammatory biomarkers in individuals with S. typhi exposure

Understanding how the absence of functional eptB contributes to S. typhi's ability to establish chronic carrier states could lead to new strategies for detecting and treating these reservoirs of infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.