Recombinant Salmonella typhimurium Phosphoglycerate transport regulatory protein pgtC (pgtC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant PgtC

Recombinant PgtC is a regulatory protein expressed in E. coli or other heterologous systems, derived from the pgtC gene of Salmonella typhimurium. It forms part of the pgtABC-P phosphoglycerate transport system, which regulates the uptake of phosphoglycerate (3-PG) in response to environmental signals . The recombinant protein retains the functional properties of its native counterpart, enabling mechanistic studies of bacterial transport regulation.

Functional Role in Phosphoglycerate Transport

PgtC operates within a two-component regulatory system alongside PgtA (response regulator) and PgtB (sensor kinase) . Key functional insights include:

  • Constitutive Activation: Deletion of pgtB and pgtC leads to constitutive expression of the transporter gene pgtP, suggesting PgtC modulates PgtA activity .

  • Signal Transduction: PgtC facilitates phosphate transfer from phosphorylated PgtB to PgtA, enabling transcriptional activation of pgtP .

  • Essential Residues: Mutations in PgtB (e.g., Arg-19 to Gln) bypass the need for PgtC, highlighting intramolecular activation mechanisms .

Production and Purification

Recombinant PgtC is typically produced in E. coli with the following specifications:

ParameterDetails
Expression SystemE. coli (e.g., plasmid pSJ11 derivatives)
TagN-terminal His tag
Purity≥85–90% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized water or buffer with 5–50% glycerol for stability

Applications in Research

  • Mechanistic Studies: Used to dissect phosphorylation cascades in bacterial two-component systems .

  • Drug Target Screening: Explored for inhibitors disrupting phosphoglycerate metabolism in pathogenic Salmonella .

  • Structural Biology: Supports crystallography and NMR studies due to high purity and solubility .

Challenges and Future Directions

  • Stability Issues: Recombinant PgtC requires glycerol or trehalose for long-term storage .

  • Interactome Mapping: Further studies needed to elucidate full interaction network with PgtA/PgtB .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pgtC; STM2398; Phosphoglycerate transport regulatory protein PgtC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-397
Protein Length
Full Length of Mature Protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
pgtC
Target Protein Sequence
WIIQRWQTEPGSVMIRTLNRTSGSLEQLLDTANAENVDLILTSSPMLLQHLQEHQKLALL DSAPAASQKLVPRSIRSTSVAVAVSGFGLLINRSALAARHLPPPADWQDMGLPSYQGALL MSSPSRSDTNHLMVESLLQQKGWTAGWATLLAISGNLVTISSRSFGVADKIKSGLGVAGP VIDNYANLLLNDPNLAFTYFPYSAVSPTYVAVLKNSRHADEARAFIHYLLSPKGQRILAD ANTGKYPVAPLSADNPRAAQQQRLMAQPPLNYRLILKRQQLVQRMFDTAISFRLAQLKDA WRALHSAETRLKRPLPEIRALLTSVPVDAASSEDETWLAQFDNKSFAEQKMMEWQIWFLN NQRLAIHKLEELK
Uniprot No.

Target Background

Function
Required for PgtP expression; it may function in conjunction with the PgtA/PgtB signaling proteins.
Database Links

KEGG: stm:STM2398

STRING: 99287.STM2398

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structure and function of the PgtC protein in Salmonella typhimurium?

The PgtC protein in Salmonella typhimurium is a regulatory protein consisting of 397 amino acid residues that functions as part of the phosphoglycerate transport system . It serves as a modulator of the activator protein PgtA, which regulates the expression of the phosphoglycerate transporter gene pgtP .

Structurally, the full-length PgtC protein spans positions 25-397 in the amino acid sequence, with recombinant versions often including His-tags for purification purposes . The protein is encoded by the pgtC gene located within a 3.4-kilobase DNA segment that also contains the pgtB gene . Together, these genes form a regulatory unit that controls phosphoglycerate transport in Salmonella.

The function of PgtC appears to be primarily regulatory, as both pgtB and pgtC genes are necessary for the expression of the pgtP gene. When both genes are deleted, a constitutive phenotype results, suggesting that PgtB and PgtC polypeptides modulate PgtA activity in response to environmental signals .

How does PgtC interact with other regulatory proteins in Salmonella typhimurium?

PgtC operates within a complex regulatory network involving multiple proteins. The most significant interaction occurs between PgtC, PgtB, and PgtA proteins. According to research findings, PgtC and PgtB modulate the activity of the PgtA activator protein, which directly regulates the expression of the phosphoglycerate transporter gene pgtP .

The proposed model of induction suggests that these three regulatory proteins interact within the membrane. The activity of the activator (PgtA) is subject to modulation through the binding of an inducer, with PgtB and PgtC playing essential roles in this regulatory mechanism . Experimental evidence from insertion and deletion studies confirms that both pgtBC genes are necessary for proper expression of the pgtP gene.

This interaction represents a sophisticated control mechanism that allows Salmonella to regulate phosphoglycerate transport in response to environmental conditions, potentially contributing to the pathogen's adaptability in various host environments.

What are the primary methods for isolating recombinant PgtC protein?

Isolation of recombinant PgtC protein typically involves expression systems with affinity tags for simplified purification. The most common approach utilizes His-tagged constructs, where the recombinant protein contains a histidine tag fused to either the N-terminus or C-terminus . This tag facilitates purification through immobilized metal affinity chromatography (IMAC).

For optimal results, researchers should:

  • Clone the pgtC gene (positions encoding amino acids 25-397) into an expression vector with a His-tag fusion

  • Transform the construct into an appropriate E. coli expression strain

  • Induce protein expression using IPTG or other inducers depending on the promoter system

  • Lyse cells under native or denaturing conditions

  • Purify using nickel-NTA or cobalt-based affinity chromatography

  • Verify protein identity and purity using SDS-PAGE and Western blotting

The expression conditions may require optimization as membrane-associated regulatory proteins like PgtC can sometimes form inclusion bodies. Solubility enhancers, lower induction temperatures (16-25°C), and specialized host strains can help improve soluble protein yields.

How can researchers effectively design gene knockout experiments to study PgtC function?

Designing effective gene knockout experiments for studying PgtC function requires careful consideration of multiple factors to ensure meaningful results. Based on previous successful studies, researchers should follow these methodological approaches:

First, create precise deletion mutants of the pgtC gene using homologous recombination techniques. This approach was effectively demonstrated in studies that analyzed the effects of insertions and deletions in pgtBC on the expression of the pgtP gene . The λ Red recombinase system can be employed for generating scarless deletions.

Second, develop complementation constructs to verify that observed phenotypes are directly attributable to pgtC loss. This should include both wild-type pgtC and mutated versions to identify crucial functional domains.

Third, implement reporter gene fusions (such as lacZ) to the pgtP promoter to quantitatively measure the regulatory effects of pgtC deletions . This approach allows for precise measurement of gene expression changes resulting from the absence of PgtC.

Fourth, design experiments that assess both single (ΔpgtC) and combination (ΔpgtBC) knockouts to distinguish between individual and coordinated regulatory effects. Previous research has shown that deletion of both genes resulted in a constitutive phenotype, revealing their coordinated role in modulating PgtA activity .

Finally, incorporate various growth conditions in your experimental design to identify environmental factors that influence PgtC function, as regulatory proteins often respond to specific external stimuli.

What are the recommended expression systems for producing functional recombinant PgtC protein?

The selection of an appropriate expression system is critical for obtaining functional recombinant PgtC protein for research purposes. Based on current literature and successful protein production strategies, the following systems are recommended:

Bacterial Expression Systems:
E. coli BL21(DE3) or its derivatives remain the most efficient hosts for producing recombinant PgtC protein, particularly when coupled with the pET expression system. These strains offer tight regulation of protein expression and reduced protease activity. For membrane-associated regulatory proteins like PgtC, specialized strains such as C41(DE3) or C43(DE3) may provide better results by accommodating membrane protein overexpression.

Optimization Parameters:

  • Induction conditions: 0.1-0.5 mM IPTG at lower temperatures (16-25°C)

  • Growth media: Enriched media such as Terrific Broth or Auto-induction media

  • Expression time: Extended periods (18-24 hours) at reduced temperatures

  • Fusion tags: His-tags have proven effective for purification of recombinant PgtC

Alternative Systems:
For cases where E. coli fails to produce properly folded PgtC, consider:

  • Cell-free expression systems that bypass inclusion body formation

  • Yeast expression systems (P. pastoris) for proteins requiring eukaryotic post-translational modifications

  • Native expression in attenuated Salmonella strains for authentic folding and processing

The inclusion of chaperone co-expression plasmids (e.g., GroEL/GroES) can significantly improve soluble protein yields by facilitating proper folding of recombinant PgtC.

How can researchers assess the interaction between PgtC and PgtA/PgtB proteins in vitro?

Assessing protein-protein interactions between PgtC and its regulatory partners PgtA and PgtB requires specialized techniques that can detect and characterize these molecular associations in vitro. The following methodological approaches are recommended:

Co-immunoprecipitation (Co-IP):
Generate antibodies against PgtC or use epitope-tagged versions of the protein. Pull-down experiments can then be conducted to identify associated proteins, followed by Western blot analysis using antibodies specific to PgtA and PgtB. This technique provides direct evidence of physical interaction within protein complexes.

Surface Plasmon Resonance (SPR):
Immobilize purified recombinant PgtC protein on a sensor chip and measure binding kinetics when purified PgtA or PgtB proteins are introduced in the mobile phase. This approach provides quantitative data on binding affinities and association/dissociation rates.

Förster Resonance Energy Transfer (FRET):
Label PgtC and its potential binding partners with appropriate fluorophore pairs. Interaction between proteins brings the fluorophores into proximity, allowing energy transfer that can be measured spectroscopically. This technique is particularly useful for detecting dynamic interactions.

Bacterial Two-Hybrid System:
Adapt bacterial two-hybrid systems to investigate PgtC interactions. Since the proposed interaction model suggests membrane localization , specialized bacterial two-hybrid systems designed for membrane proteins should be employed.

Cross-linking Studies:
Chemical cross-linking followed by mass spectrometry can identify interaction sites between PgtC and its binding partners. This approach provides detailed information about the amino acid residues involved in the interaction interface.

For comprehensive analysis, these techniques should be combined with mutational studies that identify specific domains or residues critical for the proposed regulatory interactions between PgtC, PgtA, and PgtB proteins.

How does the regulatory function of PgtC differ from similar transport regulatory proteins in other bacterial species?

The regulatory function of PgtC in Salmonella typhimurium represents a specialized adaptation that warrants comparison with analogous systems in other bacterial species. While PgtC functions specifically to modulate phosphoglycerate transport through interaction with PgtA and PgtB , comparative analysis reveals both conserved mechanisms and unique features.

Unlike many conventional two-component regulatory systems, the PgtC regulatory mechanism appears to operate through direct protein-protein interactions within a membrane-localized complex. The proposed model suggests that PgtC and PgtB collectively modulate PgtA activity, with deletion of both genes resulting in a constitutive phenotype . This indicates a repressive function that is released upon appropriate signaling.

In contrast, similar transport systems in other bacterial species often utilize different regulatory architectures:

  • E. coli phosphate transport regulators operate through well-characterized PhoBR two-component systems that sense environmental phosphate availability through phosphorylation cascades rather than direct protein interaction.

  • Pseudomonas aeruginosa transport regulators frequently incorporate small regulatory RNAs and alternative sigma factors into their regulatory networks, adding layers of post-transcriptional control absent in the PgtC system.

  • Bacillus subtilis employs riboswitches for many transport-related functions, detecting metabolite concentrations directly through mRNA conformational changes rather than protein mediators like PgtC.

The unique aspect of PgtC regulation appears to be its participation in a tripartite regulatory complex (PgtA-PgtB-PgtC) where inactivation of multiple components generates distinct phenotypes . This suggests an evolved regulatory circuit specifically tailored to Salmonella's metabolic requirements.

What role might PgtC play in Salmonella pathogenesis and host-pathogen interactions?

While direct evidence linking PgtC to Salmonella pathogenesis remains limited, its role as a regulatory protein in phosphoglycerate transport suggests potential contributions to virulence and host-pathogen interactions through several mechanisms:

First, phosphoglycerate metabolism is critical for bacterial energy production and survival within host environments. By regulating phosphoglycerate transport, PgtC likely influences the pathogen's metabolic adaptation during infection. Properly regulated transport systems are essential for bacterial survival within the nutrient-limited environment of host cells, particularly within macrophages.

Second, research on related Salmonella proteins indicates significant roles in pathogenesis. For example, the PgtE outer membrane protease of Salmonella typhimurium has been shown to defend against host antimicrobial peptides, including bactericidal/permeability increasing protein (BPI) . While PgtC and PgtE serve different functions, their shared involvement in pathogen survival mechanisms suggests potential parallel contributions to virulence.

Third, regulatory proteins often coordinate virulence factor expression in response to host-derived signals. PgtC's involvement in a complex regulatory network with PgtA and PgtB positions it as a potential environmental sensor that could detect host-derived signals and adjust bacterial physiology accordingly.

Fourth, comparison with other bacterial pathogens suggests that transport regulatory proteins frequently contribute to antimicrobial resistance by controlling efflux systems. While not directly demonstrated for PgtC, similar regulatory functions could influence Salmonella's response to host defense mechanisms or therapeutic agents.

These potential roles highlight the importance of further research investigating PgtC in the context of infection models to precisely define its contribution to Salmonella pathogenesis.

What are the challenges in developing inhibitors targeting the PgtC regulatory pathway?

Developing inhibitors against the PgtC regulatory pathway presents several significant challenges that researchers must consider when designing therapeutic interventions:

Structural Complexity:
The PgtC protein functions within a multi-protein regulatory complex involving PgtA and PgtB . This complex architecture complicates inhibitor design, as effective molecules must disrupt specific protein-protein interactions within this system. Without high-resolution structural data of the complete complex, rational drug design becomes particularly challenging.

Redundant Regulatory Mechanisms:
Bacterial regulatory networks frequently contain redundant systems that can compensate for inhibited pathways. While research shows that both pgtB and pgtC genes are necessary for normal phosphoglycerate transport regulation , Salmonella may activate alternative transport mechanisms when this pathway is compromised, potentially limiting therapeutic efficacy.

Membrane Association:
The proposed model suggests interaction of regulatory proteins in the membrane , adding another layer of complexity. Inhibitors must penetrate the bacterial outer membrane to reach their targets, presenting significant pharmacokinetic challenges in drug design and delivery.

Specificity Requirements:
Ideal inhibitors should specifically target bacterial systems without affecting host proteins. This requires detailed understanding of structural differences between bacterial transport regulatory systems and any homologous proteins in mammalian cells.

Resistance Development:
Bacteria rapidly evolve resistance mechanisms against antimicrobials. For PgtC pathway inhibitors, potential resistance mechanisms might include mutations in binding sites, overexpression of target proteins, or activation of alternative regulatory pathways.

Limited Validation Models:
Testing inhibitor efficacy requires appropriate models that accurately represent the PgtC regulatory system. Developing such models is complicated by the integrated nature of bacterial regulatory networks and challenges in replicating in vivo infection conditions.

Addressing these challenges will require multidisciplinary approaches combining structural biology, biochemistry, microbiology, and medicinal chemistry to develop effective strategies for targeting this regulatory pathway.

How should researchers interpret phenotypic changes in PgtC mutant strains compared to wild-type Salmonella?

Interpreting phenotypic changes in PgtC mutant strains requires careful analytical approaches to distinguish direct regulatory effects from indirect consequences. Researchers should implement the following framework for comprehensive analysis:

Baseline Comparisons:
Always establish clear phenotypic baselines using isogenic wild-type strains grown under identical conditions. Include both positive controls (known regulatory mutants) and negative controls (complemented mutants) to validate observed differences.

Growth Condition Variables:
Evaluate mutant phenotypes across multiple environmental conditions, as regulatory proteins often show condition-specific effects. Previous research demonstrates that deletion of both pgtB and pgtC genes resulted in a constitutive phenotype , but this may vary under different growth conditions.

Quantitative Metrics:
Employ quantitative measurements rather than qualitative observations. For example, when assessing regulatory effects on gene expression, use reporter gene fusions (like lacZ) to the pgtP gene to obtain numeric data amenable to statistical analysis.

Hierarchical Analysis:
Construct a hierarchical map of phenotypic changes by comparing single mutants (ΔpgtC) with combination mutants (ΔpgtBC) and other regulatory component deletions (ΔpgtA). This approach helps delineate the specific contribution of PgtC within the broader regulatory network .

Temporal Considerations:
Assess phenotypes across different growth phases, as regulatory effects may vary throughout the bacterial life cycle. Time-course experiments can reveal whether PgtC functions primarily during specific growth stages.

Complementation Verification:
Confirm the direct causality of observed phenotypes through genetic complementation. Introduce wild-type pgtC on a plasmid into the mutant strain and verify restoration of wild-type phenotypes. Include point mutants to identify critical functional residues.

By systematically applying these analytical approaches, researchers can effectively distinguish direct regulatory roles of PgtC from secondary effects and contextual variables.

What statistical methods are most appropriate for analyzing PgtC expression data from different experimental conditions?

For Comparing Expression Levels Across Conditions:

  • Two-way ANOVA: Particularly useful when analyzing PgtC expression across multiple variables (e.g., growth phases and environmental conditions simultaneously)

  • Student's t-test: Appropriate for simple comparisons between two conditions when data follows normal distribution

  • Mann-Whitney U test: Non-parametric alternative when normality cannot be assumed

  • Kruskal-Wallis test: For comparing expression across multiple conditions without assuming normal distribution

For Time-Course Expression Analysis:

  • Repeated measures ANOVA: Controls for within-sample variation across time points

  • Mixed-effects models: Accounts for both fixed effects (experimental conditions) and random effects (biological variation between replicates)

  • Functional data analysis: Treats expression profiles as continuous functions rather than discrete time points

For Correlation Analysis:

  • Pearson correlation: For linear relationships between PgtC expression and other variables when data is normally distributed

  • Spearman correlation: Non-parametric alternative that assesses monotonic relationships

  • Multiple regression models: Identifies combined effects of various factors on PgtC expression

Advanced Analytical Approaches:

  • Principal Component Analysis (PCA): Reduces dimensionality when examining PgtC expression alongside multiple other genes

  • Cluster analysis: Identifies patterns in expression data across multiple conditions

  • Bayesian network analysis: Models regulatory relationships between PgtC and other components of the phosphoglycerate transport system

For all analyses, researchers should:

  • Apply appropriate normalization methods to account for technical variations

  • Perform power analysis to ensure adequate sample sizes

  • Control for multiple testing when examining expression across numerous conditions

  • Report effect sizes alongside p-values to indicate biological significance

These statistical approaches provide robust frameworks for interpreting the complex regulatory patterns of PgtC expression across diverse experimental conditions.

How can researchers resolve contradictory findings about PgtC function in different experimental systems?

Resolving contradictory findings about PgtC function across different experimental systems requires a systematic approach to identify sources of variation and reconcile apparently conflicting results. Researchers should implement the following methodological framework:

Standardization of Experimental Systems:
Establish standardized protocols for PgtC functional assays that can be consistently applied across laboratories. This includes defining:

  • Specific Salmonella typhimurium strains and genetic backgrounds

  • Growth media composition and preparation methods

  • Precise environmental conditions (temperature, pH, oxygen levels)

  • Standardized gene expression measurement techniques

Meta-analysis Approach:
Conduct formal meta-analyses of published PgtC studies, weighting results based on methodological rigor, sample sizes, and statistical power. This approach can identify patterns obscured by individual study variations and highlight consistent findings across diverse experimental conditions.

Identification of Context-Dependent Variables:
Systematically test PgtC function across varying:

  • Growth phases (lag, exponential, stationary)

  • Environmental stressors (osmotic pressure, pH, antimicrobial compounds)

  • Nutrient availability conditions

  • Host cell interaction models

The constitutive phenotype observed in pgtBC deletion mutants may manifest differently depending on these contextual variables.

Integration of Multiple Data Types:
Triangulate findings using complementary methodologies:

  • In vitro biochemical assays of purified recombinant PgtC

  • Genetic studies using reporter fusions in various backgrounds

  • Structural analyses of protein-protein interactions

  • In vivo infection models examining pathogenesis effects

Collaborative Resolution Approaches:
Implement round-robin experimental validation where multiple laboratories test identical hypotheses using standardized protocols but independently executed procedures. This approach can distinguish genuine biological variability from methodological artifacts.

Computational Modeling:
Develop mathematical models of the PgtC regulatory system that can accommodate apparently contradictory data by identifying parameter spaces where different experimental outcomes are predicted under specific conditions. These models can guide experimental design to test critical predictions at boundary conditions where system behavior changes.

By systematically applying these approaches, researchers can transform apparently contradictory findings into a more comprehensive understanding of context-dependent PgtC function.

What are the most promising approaches for studying PgtC's role in bacterial metabolic regulation?

Future research into PgtC's metabolic regulatory functions should leverage cutting-edge technologies and interdisciplinary approaches to fully elucidate its role in Salmonella physiology. The following research directions hold particular promise:

Systems Biology Integration:
Apply genome-scale metabolic modeling to map how PgtC-regulated phosphoglycerate transport influences broader metabolic networks. This approach should integrate transcriptomic, proteomic, and metabolomic data to create comprehensive models of how PgtC coordinates with other regulatory systems .

Single-Cell Analysis:
Employ microfluidic platforms coupled with fluorescent reporters to track PgtC-dependent regulation at the single-cell level. This approach can reveal cell-to-cell variability in regulatory responses and identify potential bet-hedging strategies in bacterial populations facing different environmental challenges.

Structural Biology Approaches:
Determine high-resolution structures of PgtC alone and in complex with PgtA and PgtB using cryo-electron microscopy or X-ray crystallography. Structural insights will facilitate understanding of the molecular mechanisms underlying the modulatory effects observed in genetic studies .

CRISPR Interference Screening:
Implement CRISPRi approaches to create partial knockdowns of PgtC expression, allowing titration of regulatory effects. This technique permits examination of dosage-dependent phenotypes that may be missed in complete knockout studies and can reveal threshold effects in the regulatory system.

Synthetic Biology Reconstruction:
Reconstitute the minimal PgtC regulatory system in heterologous hosts lacking endogenous phosphoglycerate transport systems. This approach can isolate the core regulatory functions from confounding factors and allow precise manipulation of individual components.

Time-Resolved Techniques:
Apply time-resolved techniques such as pulse-chase metabolomics or time-lapse microscopy to capture the dynamics of PgtC-mediated regulation in response to environmental shifts. Understanding these temporal aspects is crucial for elucidating how Salmonella adapts to changing host environments during infection.

These approaches, particularly when used in combination, will provide deeper insights into PgtC's role in bacterial metabolism and potentially identify new targets for antimicrobial intervention.

How might CRISPR-based techniques advance our understanding of PgtC protein function?

CRISPR-based technologies offer unprecedented precision for manipulating genetic systems and hold significant potential for advancing our understanding of PgtC protein function through several innovative approaches:

Base-Pair Resolution Mutagenesis:
CRISPR-mediated base editing allows for precise single nucleotide modifications without introducing double-strand breaks. This technique enables systematic generation of point mutations throughout the pgtC gene to identify critical amino acid residues for:

  • Protein-protein interactions with PgtA and PgtB

  • Sensing environmental signals

  • Membrane localization

  • Regulatory function modulation

Domain-Specific Functional Analysis:
CRISPR-Cas9 coupled with homology-directed repair facilitates the creation of domain-specific deletions or domain swaps within the pgtC gene. This approach can determine which structural elements are essential for its regulatory function in the phosphoglycerate transport system.

CRISPRi for Conditional Regulation:
CRISPR interference (CRISPRi) using catalytically inactive Cas9 (dCas9) targeted to different regions of the pgtC promoter or coding sequence can achieve tunable repression. This approach allows researchers to:

  • Create hypomorphic phenotypes rather than complete knockouts

  • Implement temporal control of pgtC expression

  • Study dosage-dependent effects on regulatory networks

CRISPR-Based Imaging:
CRISPR-based imaging techniques using fluorescently tagged dCas9 can track PgtC localization in living cells without disrupting protein function. This allows visualization of dynamic changes in PgtC distribution in response to environmental stimuli or during host-pathogen interactions.

CRISPR Activation Systems:
CRISPR activation (CRISPRa) systems can be employed to enhance expression of pgtC and related genes, allowing researchers to study the effects of overexpression on regulatory networks and identify potential negative feedback mechanisms.

High-Throughput Genetic Interaction Mapping:
CRISPR-based genetic screens targeting pgtC in combination with genome-wide guide RNA libraries can systematically identify genetic interactions, revealing functional relationships with other bacterial genes and potentially uncovering new components of the regulatory network.

Implementation of these CRISPR-based approaches would significantly advance our mechanistic understanding of how PgtC functions within the complex regulatory system controlling phosphoglycerate transport in Salmonella typhimurium.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.