Recombinant Salmonella typhimurium Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
mdoB; opgB; STM4541; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
mdoB
Target Protein Sequence
MSELLSVALFLASVLIYAWKAGRNTWWFAATLTVLGLFVILNITLYASDYFTGDGINDAV LYTLTNSLTGAGVGKYILPGIGIALALVAVFGALGWVLRRRRHHPHHVGYSLLALLLALG SVDASPAFRQITELVKSQMRDGDPDFAVYYKEPAKTIPNPKLNLVYIYGESLERTYFDND AFPNLTPELGALKNEGLDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGAEELKTVVADPSYRND WGFYDDTVLDEAWKKFEALSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDYDGKPNQS FSAVSCSQENIAEFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFILRG DKPQQETLAVKRNTMDNGATVLDILGGDNFIGLGRSSLSGQSLSEVFLNVKEKVLAMKPD IIRLWNFPKEIKDFTVDRDKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWIDRCYKMAQLWAPALALSTDWCVSQGQLGGQQTVQHVDKAQWQGKTAFKD TMIDMERYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKAPLPKKFDLVITAKAFGDNANRPIPVRVGNEEQTLVLGHDVSTITLHFNNP TDANTLVIAPPAPVSTNEGNILGHSPRKLGIGMVEIKVVNVES
Uniprot No.

Target Background

Function
Transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links

KEGG: stm:STM4541

STRING: 99287.STM4541

Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant Salmonella typhimurium mdoB protein?

Recombinant S. typhimurium mdoB is typically expressed using either homologous or heterologous expression systems. For homologous expression, modified S. typhimurium strains with the nirB promoter provide excellent control of protein expression under anaerobic conditions. This approach is particularly valuable when studying the native protein behavior and interactions .

For heterologous expression, E. coli DH5-α has proven effective when transformed with appropriate plasmid constructs containing the mdoB gene. Both systems typically employ ampicillin resistance markers for selection, with protein expression typically induced under specific controlled conditions. When using the nirB promoter system, expression should be conducted in anaerobic conditions, which can be achieved using thioglycollate broth to promote an oxygen-depleted environment .

What are the optimal conditions for inducing mdoB expression in recombinant systems?

For optimal mdoB expression using the nirB promoter system (which is inducible under anaerobic conditions):

ParameterOptimal ConditionNotes
Temperature37°CStandard for most bacterial expression
Agitation200 rpmAllows sufficient mixing while maintaining low oxygen levels
Growth phaseOD600 of 1.0 before transferEnsures sufficient cell density before anaerobic induction
Anaerobic induction time10-12 hoursSufficient for protein accumulation without excessive stress
Selective agentAmpicillin (100 μg/ml)Maintains plasmid selection
SupplementsDHB (0.01%) may be required2,3-dihydroxybenzoic acid supports growth under limited conditions

The induction should occur after transferring cells to anaerobic conditions, typically in thioglycollate broth. This creates the necessary environment for the nirB promoter activation while supporting continued bacterial growth .

How can I verify successful expression of recombinant mdoB protein?

Verification of successful mdoB expression involves multiple complementary techniques:

  • Western blot analysis: Using antibodies against epitope tags (such as Flag tag) can confirm the presence of the expected ~75 kDa protein band, depending on your construct design .

  • Immunofluorescence (IFA): This can be used to visualize the cellular localization of the expressed protein, particularly useful if you're studying membrane association.

  • Flow cytometry: Particularly valuable for quantifying surface expression levels when using autotransporter systems like MisL, which can display proteins on the bacterial surface .

  • DotBlot assays: A rapid screening method to detect protein expression before proceeding to more detailed analyses.

  • Functional assays: Measuring phosphoglycerol transferase activity using appropriate substrates provides functional verification of properly folded protein.

For membrane-associated proteins like mdoB, it's advisable to conduct both whole-cell and membrane fraction analyses to determine the distribution between cytoplasmic and membrane compartments .

What methodologies are most reliable for assessing the enzymatic activity of recombinant mdoB?

The enzymatic activity of recombinant mdoB can be reliably assessed through several complementary approaches:

  • Phosphoglycerol transfer assay: Measuring the transfer of phosphoglycerol groups from radiolabeled phosphatidylglycerol to acceptor oligosaccharides. The reaction products can be separated by thin-layer chromatography or high-performance liquid chromatography.

  • Substrate uptake measurements: Similar to methods used for studying phosphoglycerate transport systems in Salmonella, using radiolabeled substrates like 3-phospho[14C]glycerate can reveal transport kinetics and substrate specificity .

  • Growth complementation assays: Using mdoB-deficient mutants supplemented with the recombinant protein to assess functional restoration of growth on specific carbon sources.

When conducting these assays, it's crucial to maintain appropriate pH (optimally pH 6) and include exogenous energy sources to support maximal activity. The apparent Km for related phosphoglycerate systems in Salmonella is approximately 10^-4 M, which can serve as a reference point for expected kinetic parameters .

How does the membrane localization of mdoB affect its functional properties?

As a membrane-associated protein, the functional properties of mdoB are significantly influenced by its membrane localization. Research indicates that:

  • Lipid environment: The phospholipid composition of the membrane directly affects mdoB activity, with phosphatidylglycerol serving both as a substrate and as a regulatory factor.

  • Potassium dependence: Similar to other Salmonella membrane transport systems, the maximal activity rate (but not Km) of related phosphoglycerate systems shows dependence on potassium ions, suggesting a role for ionic interactions in the catalytic mechanism .

  • Surface expression systems: When using autotransporter systems like MisL to express mdoB on the bacterial surface, protein functionality may be affected by the presentation mode. Immunoelectron microscopy can confirm proper surface localization .

For optimal functional studies, it's advisable to maintain the protein in appropriate membrane mimetics (detergent micelles or liposomes) after purification to preserve the native structure and activity.

What are the known regulatory mechanisms controlling mdoB expression and activity?

The regulation of mdoB expression and activity involves multiple mechanisms:

  • Anaerobic regulation: The nirB promoter commonly used for expression is inducible under anaerobic conditions, indicating that oxygen levels serve as a physiological regulator of expression .

  • Cyclic AMP-dependent regulation: Similar to other Salmonella transport systems, mdoB regulation appears to be under adenosine 3':5'-monophosphate (cAMP) control, suggesting integration with global carbon metabolism regulation .

  • Glucose repression: Unlike many metabolic genes, glucose causes only slight repression of related phosphoglycerate transport systems in Salmonella, indicating a unique regulatory pattern .

  • Substrate-based induction: Expression can be induced by the presence of substrates like phosphoenolpyruvate and phosphoglycerates, suggesting substrate-responsive regulation .

Understanding these regulatory mechanisms is crucial when designing expression systems and interpreting physiological data from recombinant mdoB studies.

How can recombinant mdoB be utilized for studying bacterial membrane biogenesis?

Recombinant mdoB serves as an excellent tool for studying bacterial membrane biogenesis through several sophisticated approaches:

  • Membrane modification tracking: By expressing epitope-tagged mdoB variants, researchers can track the incorporation of phosphoglycerol groups into membrane-derived oligosaccharides using immunological methods.

  • Membrane stress response studies: Since mdoB function relates to membrane integrity, recombinant versions can be used to study how bacteria adapt to membrane perturbations caused by environmental stressors.

  • Comparative genomics approach: The pgt genes controlling phosphoglycerate transport systems in Salmonella map to approximately 74 minutes on the Salmonella chromosome . This genomic context can provide insights into the evolutionary and functional relationships of mdoB with other membrane biogenesis factors.

  • Bacterial mutant complementation: Recombinant mdoB can be used to complement mdoB-deficient bacterial strains, enabling detailed structure-function studies by introducing specific mutations and assessing their impact on membrane composition.

For these applications, it's crucial to verify both the expression and correct localization of the recombinant protein, typically using immunohistochemical methods similar to those used to detect Salmonella in tissue samples .

What are the challenges in distinguishing the function of mdoB from other phosphoglycerol transferases?

Distinguishing the specific function of mdoB from other phosphoglycerol transferases presents several methodological challenges:

  • Functional redundancy: Bacteria often possess multiple enzymes with overlapping activities. To address this, researchers can use knockout mutants lacking specific transferases to isolate the function of mdoB.

  • Substrate specificity overlap: Similar enzymes may act on overlapping substrate pools. Comparative inhibition studies using various substrates can help identify specific patterns:

SubstrateEffect on mdoBEffect on Related Transferases
PhosphoenolpyruvateStrong inhibitionVariable inhibition
2-PhosphoglycerateStrong inhibitionVariable inhibition
3-PhosphoglycerateStrong inhibitionVariable inhibition
GlycerateMinimal effectMay affect related enzymes
α-GlycerophosphateMinimal effectMay affect related enzymes
  • Enzyme kinetics differentiation: Careful analysis of kinetic parameters (Km, Vmax) under various conditions can reveal distinguishing characteristics. For instance, related phosphoglycerate systems show maximal activity at pH 6 and exhibit potassium dependence for maximal uptake rate but not Km .

  • Allosteric regulation patterns: Different transferases often respond differently to allosteric regulators, providing another means of functional differentiation.

How can advanced enzyme inhibition studies of mdoB contribute to antimicrobial research?

Advanced enzyme inhibition studies of mdoB offer significant potential for antimicrobial research:

  • Inhibition mechanism analysis: Understanding the four main types of enzyme inhibition (competitive, uncompetitive, mixed, and noncompetitive) as they apply to mdoB can guide rational inhibitor design . For instance:

    • Competitive inhibitors would bind to the mdoB active site, directly competing with natural substrates

    • Noncompetitive inhibitors would bind to allosteric sites, inducing conformational changes that reduce activity without altering substrate binding affinity

    • Uncompetitive inhibitors would target the enzyme-substrate complex

    • Mixed inhibitors would affect both free enzyme and enzyme-substrate complexes

  • Lineweaver-Burk and Michaelis-Menten analysis: These graphical representations can reveal the precise mechanism of potential inhibitors, as illustrated for various enzyme inhibition types :

    • Competitive inhibition increases Km without changing Vmax

    • Noncompetitive inhibition decreases Vmax without changing Km

    • Uncompetitive inhibition decreases both Km and Vmax

  • Structure-based drug design: Using recombinant mdoB for crystallography or cryo-EM studies can provide structural insights for designing specific inhibitors targeting unique features of the bacterial enzyme.

  • Bacterial targeting verification: Similar to methods used for other recombinant Salmonella experiments, researchers can verify bacterial targeting in various models, quantifying bacteria through techniques like CFU counting from tissue homogenates .

What strategies can overcome low solubility issues when expressing recombinant mdoB?

Low solubility is a common challenge when expressing membrane-associated proteins like mdoB. Several strategies can address this issue:

  • Expression temperature optimization: Reducing the expression temperature to 16-25°C can slow protein synthesis, allowing more time for proper folding and membrane integration.

  • Fusion tags selection: Solubility-enhancing fusion partners such as MBP (maltose-binding protein), SUMO, or Thioredoxin can significantly improve solubility. For surface display, autotransporter systems like MisL have proven effective for Salmonella proteins .

  • Detergent screening: Systematic screening of detergents for protein extraction and purification is crucial. A typical panel might include:

Detergent ClassExamplesBest For
Non-ionicDDM, Triton X-100Initial extraction
ZwitterionicLDAO, CHAPSPurification steps
Peptide-basedSMA, amphipolsMaintaining native lipid environment
  • Membrane fraction preparation: Rather than attempting to solubilize the protein completely, working with membrane fractions or reconstituting purified protein into liposomes can maintain the native environment necessary for proper folding and function.

  • Periplasmic expression: Directing the protein to the periplasm using appropriate signal sequences can sometimes improve folding and stability of membrane-associated proteins.

How can researchers address inconsistent enzymatic activity in purified recombinant mdoB preparations?

Inconsistent enzymatic activity in purified recombinant mdoB can stem from multiple sources. Addressing these systematically:

  • Lipid environment restoration: Including appropriate phospholipids (particularly phosphatidylglycerol, a substrate for mdoB) in the purification buffers can help maintain the functional conformation of the enzyme.

  • Metal ion requirements: Similar to other membrane enzymes, mdoB activity may depend on specific metal ions. A systematic screening of various metal ions (Mg²⁺, Mn²⁺, Ca²⁺) in the reaction buffer can identify essential cofactors.

  • Oxidation prevention: Including reducing agents (DTT, β-mercaptoethanol) in buffers can prevent oxidation of critical cysteine residues that might affect activity.

  • pH optimization: Activity of related phosphoglycerate systems is optimal at pH 6 , suggesting that careful pH control is essential for consistent activity measurements.

  • Potassium dependence: The maximal activity (but not Km) of related transport systems depends on potassium ions , indicating that potassium concentration should be carefully controlled in activity assays.

  • Storage conditions optimization: Testing various storage conditions (temperature, glycerol percentage, buffer composition) can identify parameters that preserve activity during storage.

What are the most effective methods for verifying the correct membrane localization of recombinant mdoB?

Verifying correct membrane localization of recombinant mdoB requires multiple complementary approaches:

  • Fractionation studies: Systematic separation of cytoplasmic, periplasmic, and membrane fractions followed by immunoblotting can determine the distribution of mdoB across cellular compartments.

  • Immunoelectron microscopy: This provides direct visualization of protein localization at the ultrastructural level, particularly valuable for confirming surface display when using autotransporter systems like MisL .

  • Protease accessibility assays: Limited proteolysis of intact cells versus permeabilized cells can distinguish between protein domains exposed to different cellular compartments.

  • Surface labeling: For surface-displayed versions of mdoB (using systems like MisL autotransporter), flow cytometry using antibodies against epitope tags provides quantitative data on surface exposure levels .

  • Functional complementation: Testing whether the recombinant protein can restore function in mdoB-deficient strains provides functional evidence of correct localization.

Researchers have successfully used these approaches to verify the surface expression of various recombinant proteins in Salmonella, with immunofluorescence, flow cytometry, and immunoelectron microscopy being particularly informative for confirming proper localization .

How might CRISPR-Cas9 genome editing enhance studies of mdoB function in Salmonella typhimurium?

CRISPR-Cas9 genome editing offers transformative approaches for studying mdoB function:

  • Precise genomic modifications: Rather than relying on plasmid-based expression, CRISPR enables direct modification of the chromosomal mdoB gene, allowing studies under native regulatory control.

  • Scarless mutations: Creating point mutations, deletions, or insertions without introducing selection markers minimizes confounding effects on gene expression and protein function.

  • Regulator identification: CRISPR interference (CRISPRi) or activation (CRISPRa) systems can help identify regulators of mdoB expression by systematically targeting potential regulatory genes.

  • Multiplex modifications: Simultaneous editing of mdoB and related genes can reveal functional relationships and redundancies within membrane biogenesis pathways.

  • Tagged endogenous protein: Adding epitope or fluorescent tags to the chromosomal copy of mdoB enables tracking of the native protein without overexpression artifacts.

This approach builds upon established transformation techniques for Salmonella, which have previously demonstrated effectiveness for introducing recombinant constructs through methods like electroporation .

What emerging analytical techniques show promise for elucidating the structural dynamics of mdoB during catalysis?

Several cutting-edge analytical techniques show exceptional promise for understanding mdoB structural dynamics:

  • Cryo-electron microscopy (cryo-EM): Recent advances allow visualization of membrane proteins in near-native environments, potentially revealing conformational changes during catalysis.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map dynamic regions and conformational changes in the protein under various conditions, providing insights into the catalytic mechanism.

  • Single-molecule FRET (smFRET): By labeling specific residues with fluorophore pairs, researchers can track distance changes during substrate binding and catalysis in real-time.

  • Native mass spectrometry: This approach can capture intact protein-lipid complexes, revealing how the lipid environment influences mdoB structure and oligomerization state.

  • Molecular dynamics simulations: Computational approaches can model protein-membrane interactions and substrate binding events at atomic resolution, generating testable hypotheses about catalytic mechanisms.

These methods complement traditional approaches like X-ray crystallography and enzyme kinetics studies, offering dynamic information rather than static snapshots of protein structure.

How can systems biology approaches integrate mdoB function into broader models of bacterial membrane homeostasis?

Systems biology offers powerful frameworks for contextualizing mdoB function within bacterial physiology:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from wild-type and mdoB-mutant strains can reveal the system-wide impact of mdoB activity on cellular processes.

  • Flux balance analysis: Mathematical modeling of metabolic networks incorporating mdoB activity can predict how alterations in phosphoglycerol transfer affect global cellular metabolism.

  • Protein-protein interaction networks: Techniques like bacterial two-hybrid screening or proximity labeling can identify interaction partners of mdoB, placing it within functional complexes.

  • Synthetic lethality screening: Systematic creation of double mutants can identify genes that become essential when mdoB function is compromised, revealing functional redundancies.

  • Comparative genomics across pathogens: Analyzing mdoB homologs across diverse bacterial species can reveal evolutionary adaptations in membrane biogenesis systems.

These approaches extend beyond traditional reductionist studies to understand how mdoB contributes to the emergent properties of bacterial membranes under various environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.