Recombinant Salmonella typhimurium Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Functional Context from Related Salmonella Proteins

While YciB remains understudied, homologs and adjacent genes in Salmonella typhimurium provide clues to its potential roles:

YciF (DUF892 Family Protein)

  • Binds iron and exhibits ferroxidase activity, critical for mitigating reactive oxygen species (ROS) during bile stress .

  • Mutations in its metal-binding sites abolish enzymatic function, highlighting conserved active residues .

YqiC (Oligomeric Protein)

  • Forms homotrimers via C-terminal coiled-coil domains, essential for host cell invasion and colonization .

  • Interacts with electron transport chain components (e.g., SdhA, SdhB), suggesting metabolic regulation ties to virulence .

These studies imply that YciB, as a putative septation protein, may contribute to cell division or stress adaptation, though direct evidence is lacking.

Research Gaps and Future Directions

  • Functional Role: No studies directly link YciB to septation or stress responses. Comparative analysis with homologs (e.g., Bacillus subtilis SpoIID) could clarify its mechanism.

  • Immunogenicity: Recombinant Salmonella outer membrane proteins (e.g., OmpA) elicit strong T-cell responses , but YciB’s antigenicity remains untested.

  • Structural Insights: The protein’s α-helical regions suggest potential oligomerization, akin to YqiC , warranting crystallography studies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yciB; STM1735; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Uniprot No.

Target Background

Function

This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.

Database Links

KEGG: stm:STM1735

STRING: 99287.STM1735

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How Do Researchers Express and Purify Recombinant YciB for Experimental Studies?

Expression and purification of recombinant YciB typically follows these methodological steps:

  • Cloning strategy: The full-length yciB gene (spanning region 1-179) is amplified from S. typhimurium genomic DNA using PCR with specific primers that include appropriate restriction sites.

  • Expression vector selection: The gene is inserted into a prokaryotic expression vector, often containing a tag (such as His-tag, Strep-tag, or FLAG-tag) for purification purposes.

  • Host system selection: Due to YciB being a membrane protein, specialized E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) are preferred.

  • Expression conditions: Typical conditions include induction with IPTG (0.1-1 mM) at mid-log phase, followed by growth at lower temperatures (16-25°C) for 4-18 hours to facilitate proper folding.

  • Membrane fraction isolation: Bacterial cells are lysed, and the membrane fraction is isolated through differential centrifugation.

  • Solubilization: Membrane proteins are solubilized using detergents like n-dodecyl-β-D-maltoside (DDM) or Triton X-100.

  • Purification: Affinity chromatography using the attached tag, followed by size exclusion chromatography to achieve high purity.

Commercial preparations of recombinant YciB are stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage .

What is the Role of YciB in Lipoprotein Processing and Membrane Homeostasis?

Genetic studies have revealed that YciB functions in maintaining proper membrane homeostasis, particularly in the context of lipoprotein processing:

  • Synthetic lethality: The deletion of both yciB and dcrB genes results in conditional lethality, indicating their synergistic relationship in maintaining cell envelope integrity .

  • Lipoprotein maturation: In yciB dcrB double mutants, there are defects in the first step of lipoprotein maturation, specifically in the Lgt-catalyzed diacylglyceryl transfer to preprolipoproteins .

  • Stress response activation: The double mutant shows upregulation of both Rcs and Cpx envelope stress response systems, indicating severe membrane stress .

  • Membrane fluidity: YciB likely contributes to maintaining proper membrane fluidity, as the yciB dcrB double mutant shows altered membrane properties and fatty acid composition .

  • Lipoprotein mislocalization: In the absence of YciB and DcrB, the abundant outer membrane lipoprotein Lpp mislocalizes to the inner membrane, where it forms toxic linkages to peptidoglycan .

This mechanistic understanding suggests that YciB functions as part of a system that maintains proper membrane architecture and protein localization in Gram-negative bacteria.

How Does YciB Compare to Similar Proteins in Other Bacterial Species?

YciB belongs to a family of conserved membrane proteins found across multiple bacterial species:

SpeciesProtein HomologSequence Identity to S. typhimurium YciBPutative Function
E. coliYciB>90%Cell division, membrane integrity
Shigella spp.YciB>90%Unknown, likely membrane homeostasis
Klebsiella spp.YciB homolog~85-90%Unknown
Other Salmonella serovarsYciB100% (between common pathogenic serovars)Membrane integrity, possible role in virulence

The high conservation of YciB, particularly the presence of identical sequences across different Salmonella serovars (Typhimurium, Typhi, Enteritidis, and Choleraesuis), suggests an important functional role .

For experimental studies comparing YciB function across species, researchers typically use complementation assays, where the yciB gene from different species is expressed in a S. typhimurium yciB mutant to assess functional conservation.

What Experimental Approaches Are Used to Study YciB Function in Salmonella?

Several methodological approaches have been developed to investigate YciB function:

  • Genetic manipulation techniques:

    • Gene deletion studies using lambda Red recombinase system

    • Complementation with plasmid-expressed YciB

    • Site-directed mutagenesis to identify critical residues

  • Protein localization methods:

    • Fluorescent protein fusions (GFP, mCherry) to determine subcellular localization

    • Membrane fractionation followed by Western blotting

    • Immunogold electron microscopy for high-resolution localization

  • Protein-protein interaction studies:

    • Bacterial two-hybrid assays

    • Co-immunoprecipitation with tagged versions of YciB

    • Cross-linking studies followed by mass spectrometry

  • Phenotypic characterization:

    • Membrane integrity assays (using dyes like propidium iodide)

    • Lipoprotein processing assessment using pulse-chase experiments

    • Antibiotic sensitivity profiling (particularly to compounds affecting membrane integrity)

  • Structural studies:

    • Circular dichroism spectroscopy to analyze secondary structure

    • NMR or crystallography for detailed structural information

    • Computational modeling based on homologous proteins

These methodological approaches provide complementary information about YciB's structure, function, and role in bacterial physiology .

How Does YciB Contribute to Salmonella Pathogenesis and Intracellular Survival?

While direct evidence linking YciB to Salmonella virulence is limited, several findings suggest potential contributions to pathogenesis:

  • Membrane integrity: As a protein involved in maintaining membrane homeostasis, YciB likely contributes to bacterial survival under stress conditions encountered during infection .

  • Comparison with similar proteins: Small membrane proteins in Salmonella, such as YshB (which shares some characteristics with YciB), have been shown to be upregulated during macrophage infection and to contribute to intracellular survival .

  • Environmental adaptation: The yciB gene may be part of the bacterial response to changing environments during infection. Other small proteins in Salmonella are known to be differentially regulated during the intracellular phase of infection .

  • Potential interaction with host defenses: Proper membrane composition is essential for resisting host antimicrobial peptides and other defense mechanisms, suggesting YciB could indirectly affect this resistance.

For researchers investigating YciB's role in pathogenesis, cell culture infection models using macrophages (RAW 264.7 cells) or epithelial cells (HeLa) are commonly employed, followed by assessment of bacterial survival and replication rates .

What Are the Effects of YciB Deletion on Bacterial Physiology and Stress Response?

Deletion of the yciB gene produces several notable phenotypic changes:

  • Altered stress response activation: The yciB single mutant shows approximately 3-fold increase in Cpx stress response activation compared to wild-type, although the Rcs stress response is not significantly affected in the single mutant .

  • Synthetic phenotypes: While yciB deletion alone has moderate effects, the combination with dcrB deletion results in severe defects in:

    • Lipoprotein processing

    • Membrane integrity

    • Growth under specific conditions

    • Resistance to membrane-targeting compounds

  • Metal sensitivity: The yciB mutant shows increased sensitivity to copper ions, with an MIC of approximately 2.25 mM compared to higher tolerance in wild-type cells .

  • Stress signaling: The mechanisms of stress in yciB mutants appear to be partially independent of lipoprotein maturation defects, suggesting YciB has multiple functions in bacterial physiology .

These findings indicate that YciB is part of a complex network maintaining bacterial envelope homeostasis, with its absence triggering compensatory mechanisms that can be experimentally measured through stress response reporters.

How Can Structural Analysis of YciB Inform Antimicrobial Development?

Structural analysis of YciB offers several avenues for antimicrobial development:

  • Membrane protein targeting: As an integral membrane protein potentially involved in essential cellular processes, YciB represents a class of targets that have been historically underexploited in antibacterial discovery.

  • Conservation across pathogens: The high conservation of YciB across Enterobacteriaceae (>80% sequence identity) suggests that targeting this protein could affect multiple bacterial pathogens .

  • Structure-based design approaches:

    • Identification of small molecule binding pockets using computational modeling

    • Design of peptidomimetics that disrupt YciB-protein interactions

    • Development of compounds that alter YciB conformation or stability

  • Functional interfaces: Targeting the interfaces between YciB and other proteins involved in lipoprotein processing could disrupt essential bacterial processes.

  • Potential selectivity: Despite conservation, subtle differences between bacterial YciB proteins might allow for selective targeting of pathogenic species over commensals.

Researchers typically employ a combination of computational modeling, high-throughput screening, and structure-activity relationship studies to identify compounds that could interfere with YciB function.

What Is the Relationship Between YciB and Other Bacterial Stress Response Systems?

YciB interacts with multiple stress response systems in bacteria:

  • Cpx system: The Cpx two-component system, which responds to envelope stress, shows increased activation in yciB mutants. Interestingly, this activation occurs independently of NlpE, a common activator of Cpx, suggesting alternative activation mechanisms .

  • Rcs system: The Rcs phosphorelay system, which responds to outer membrane and peptidoglycan stress, is activated in the yciB dcrB double mutant but not significantly in the yciB single mutant. This activation is largely dependent on the stress sensor RcsF .

  • Connection to lipoprotein processing: The stress response activation in yciB mutants is partially, but not completely, related to lipoprotein maturation defects. Overexpression of Lgt (which catalyzes the first step in lipoprotein maturation) reduces Rcs activation substantially but only modestly reduces Cpx activation .

  • Broader stress networks: YciB function appears to be connected to systems that maintain membrane homeostasis under various stress conditions, including temperature changes that affect membrane fluidity .

For researchers investigating these connections, genetic approaches combining deletions of yciB with mutations in various stress response components, coupled with reporter systems measuring stress response activation, provide valuable insights.

How Does YciB Compare to YshB and Other Small Proteins in Salmonella Virulence?

Several small proteins contribute to Salmonella virulence and intracellular survival, with interesting comparisons to YciB:

  • YshB characteristics:

    • 5-kDa protein involved in intracellular survival

    • Expression upregulated when bacteria enter macrophages

    • Deletion reduces bacterial survival within macrophages

    • Contributes to virulence in mouse models

  • Functional comparison:

    • While YciB (19-20 kDa) is larger than YshB (5 kDa), both appear to be membrane-associated proteins

    • YshB has a clearly demonstrated role in intracellular survival, while YciB's role is more focused on membrane homeostasis

    • YshB expression is regulated in response to the intracellular environment, while YciB regulation is less well characterized

  • Evolutionary conservation:

    • YshB shows 100% sequence identity among common pathogenic Salmonella serovars

    • YshB is 92% identical (33/36 amino acids) to homologs in E. coli, Shigella, and Klebsiella

    • This pattern of conservation is similar to that observed for YciB

  • Experimental approaches:

    • For both proteins, genetic deletion studies combined with infection models are valuable

    • Reporter fusions to monitor expression during infection provide insights into regulation

    • Bacterial two-hybrid and co-immunoprecipitation methods can identify interaction partners

Understanding the similarities and differences between these small proteins contributes to a more comprehensive picture of how Salmonella adapts to intracellular environments.

What Are the Methodological Challenges in Working with Recombinant YciB?

Researchers face several technical challenges when working with recombinant YciB:

  • Membrane protein expression issues:

    • Low expression yields due to toxicity or aggregation

    • Proper membrane insertion and folding in heterologous systems

    • Need for specialized expression strains and conditions

  • Solubilization and purification challenges:

    • Selection of appropriate detergents that maintain protein structure and function

    • Optimization of purification protocols to prevent aggregation

    • Maintaining stability during concentration and storage

  • Functional assays:

    • Difficulty in developing in vitro assays that recapitulate membrane environment

    • Need for reconstitution in artificial membranes or nanodiscs

    • Complexity of interpreting results from engineered systems

  • Structural analysis limitations:

    • Challenges in obtaining crystals for X-ray crystallography

    • Size limitations for NMR analysis

    • Detergent micelles complicating structural determination

  • Storage and stability:

    • Prevention of freeze-thaw cycles that can denature membrane proteins

    • Need for glycerol or other stabilizing agents

    • Limited shelf-life compared to soluble proteins

Researchers typically address these challenges through careful optimization of each experimental step and the use of multiple complementary approaches to verify findings.

How Can Gene Regulatory Networks Controlling YciB Expression Be Studied?

Understanding the regulation of yciB expression requires specialized approaches:

  • Transcriptional analysis techniques:

    • Quantitative RT-PCR to measure yciB mRNA levels under different conditions

    • RNA-seq to place yciB in broader transcriptional networks

    • Promoter fusion reporters (lacZ, luciferase, fluorescent proteins) to monitor expression dynamics

  • Promoter analysis methods:

    • 5' RACE to identify transcription start sites

    • Promoter truncation and mutation studies to identify regulatory elements

    • ChIP-seq to identify transcription factors binding to the yciB promoter

  • Regulatory network mapping:

    • Transposon insertion libraries to identify genes affecting yciB expression

    • Epistasis analysis with known regulators of membrane homeostasis

    • Systems biology approaches integrating multiple datasets

  • Environmental condition screening:

    • Examination of yciB expression under various stresses (pH, temperature, antimicrobials)

    • Expression analysis during infection of host cells

    • Comparison of expression patterns between different Salmonella strains

  • Post-transcriptional regulation:

    • Investigation of potential small RNA regulators

    • Analysis of mRNA stability and translation efficiency

    • Ribosome profiling to assess translational regulation

These approaches provide a comprehensive understanding of how yciB expression is controlled in response to changing environmental conditions, potentially revealing new insights into Salmonella adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.