Recombinant Salmonella typhimurium Nitrite transporter NirC (nirC)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms

NirC exhibits dual transport modes, acting as both a channel and an antiporter. Experimental data highlight:

MechanismDetailsSubstrateConductancepH DependenceSource
Channel ModeFacilitates passive nitrite diffusionNO₂⁻24 pS (single-channel)Voltage-independent
Antiporter ModeCouples nitrite uptake to H⁺ effluxNO₂⁻Low affinitypH 6–8 (independent)
Substrate SpecificityTransports nitrate (NO₃⁻) at reduced flux without proton couplingNO₃⁻~70% of NO₂⁻ permeabilityN/A

Electrophysiological studies confirm NirC’s ability to translocate negative charges (e.g., nitrite) across lipid bilayers, with proton antiport activity observed under specific conditions .

Biological Significance

NirC is essential for S. typhimurium survival and pathogenicity:

Role in Nitrite Detoxification

  • Mechanism: Imports nitrite into the cytoplasm for reduction by NirB or NirD enzymes .

  • Pathogenicity: Deletion of nirC reduces intracellular replication in macrophages and systemic infection in mice .

  • Host Interaction: Counteracts host-derived nitrite (e.g., from macrophage NO production), preventing oxidative damage .

Regulation

NirC expression is induced by:

  • FNR (anaerobic conditions)

  • NarL/NarP (nitrate/nitrite presence) .

Research Applications

The recombinant NirC protein (His-tagged, 1–269aa) is widely used for:

ApplicationDetailsSource
Structural StudiesLipid bilayer electrophysiology, X-ray crystallography
Functional AssayspH-dependent transport kinetics, substrate specificity testing
Drug Target DevelopmentScreening for antimicrobial agents targeting nitrite transport

Commercial availability (e.g., Creative Biomart RFL1522SF) enables high-throughput studies .

Key Research Findings

  1. Electrogenicity: NirC mediates voltage-independent nitrite transport but exhibits proton antiport activity at low pH .

  2. Dual Specificity: Transport of nitrate occurs but lacks proton coupling, suggesting distinct binding sites .

  3. Virulence Link: nirC mutants show impaired replication in macrophages and reduced systemic infection in mice .

  4. Structural Insights: Resolved water molecules in crystal structures suggest a hydrated transport pathway .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nirC; STM3476; Nitrite transporter NirC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
nirC
Target Protein Sequence
MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLVMGATFGIALTLVIIAGSELFTGHTMFLTLGVKAGTISHGQMWAILPQTWLGNLVGSVFVALLYSWGGGSLLPVDTSIVHSVALAKTTAPATVLFFKGALCNWLVCLAIWMAIRTEGTAKFLAIWWCLLAFIASGYEHSVANMTLFALSWFGHHSDAYTLAGIGHNLLWVTLGNTLSGVVFMGLGYWYATPKSERPAPAKINQPEAAANN
Uniprot No.

Target Background

Function

Function: Catalyzes nitrite uptake and export across the cytoplasmic membrane.

Database Links

KEGG: stm:STM3476

STRING: 99287.STM3476

Protein Families
FNT transporter (TC 2.A.44) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional characterization of the nitrite transporter NirC in Salmonella typhimurium?

NirC is an integral membrane protein belonging to the formate-nitrite transporter (FNT) family that facilitates the transport of nitrite anions across lipid bilayers. Structural and functional characterization through X-ray crystallography and lipid bilayer electrophysiology has revealed its electrogenicity and specific substrate preference for nitrite. The protein demonstrates the ability to translocate negative charges into proteoliposomes when reconstituted with purified StmNirC, confirming its role as a secondary active transporter .

Experimental methods for characterization include:

  • Purification and reconstitution into proteoliposomes

  • Electrophysiological techniques using solid supported membranes

  • pH monitoring in everted membrane vesicles using acridine orange as a pH indicator

How is NirC genetically organized and regulated in Salmonella typhimurium?

In enteric bacteria such as Salmonella typhimurium, NirC is encoded by the third gene of the nirBDCcysG operon. Its expression is regulated by multiple transcription factors responding to environmental conditions:

  • FNR responds to anoxic conditions

  • NarL is stimulated by nitrate

  • NarP is stimulated by both nitrate and nitrite

This complex regulatory network enables Salmonella to modulate NirC expression in response to changing environmental conditions, particularly during infection when nitrite concentrations may fluctuate.

What are the optimal methods for expressing and purifying recombinant NirC from Salmonella typhimurium?

For efficient expression and purification of recombinant NirC, researchers typically employ balanced-lethal vector-host systems that ensure plasmid stability without requiring antibiotic selection markers. This approach is particularly important when working with live Salmonella strains for in vivo applications .

Methodological steps include:

  • Construction of expression vectors containing the nirC gene under control of an inducible promoter

  • Transformation into an appropriate Salmonella host strain

  • Membrane fraction isolation from bacterial cultures

  • Detergent-based solubilization of the membrane protein

  • Affinity chromatography using engineered tags

  • Size exclusion chromatography for final purification

The araC PBAD activator-promoter system has shown particular efficacy for controlled expression of membrane proteins in Salmonella, offering tight regulation and inducible expression .

How can researchers effectively measure NirC transport activity in vitro?

To assess NirC transport activity, several complementary approaches can be employed:

  • Electrophysiological measurements:

    • Solid supported membrane (SSM)-based electrophysiology to detect nitrite-induced charge translocation

    • Patch-clamp techniques for single-channel measurements

  • pH-dependent assays:

    • Monitoring ΔpH changes in everted membrane vesicles using pH-sensitive fluorescent dyes like acridine orange

    • Quantifying proton flux associated with nitrite transport

  • Radiolabeled substrate tracking:

    • Using isotope-labeled nitrite to measure transport rates

    • Scintillation counting to quantify substrate accumulation

Each method provides distinct insights into transport kinetics, substrate specificity, and electrogenicity of the NirC transporter.

How does NirC contribute to Salmonella typhimurium virulence and intracellular survival?

NirC plays a critical role in Salmonella pathogenesis by facilitating nitrite transport, which supports bacterial survival within host cells. During infection, macrophages produce nitric oxide (NO) as an antimicrobial defense mechanism. Salmonella counters this through several mechanisms involving NirC:

  • Nitrite import facilitates nitrite reduction to ammonia, decreasing toxic nitrite accumulation

  • NirC activity may help maintain cytoplasmic pH homeostasis during acid stress encountered in phagosomes

  • The transporter contributes to nitrogen metabolism pathways essential for intracellular replication

Notably, NirC expression increases under nitrosative stress conditions, and mutants lacking functional NirC show attenuated virulence in infection models, highlighting its importance for intracellular survival and pathogenesis .

What is the relationship between NirC and nitric oxide detoxification systems in Salmonella?

NirC functions within a complex network of nitrosative stress response systems in Salmonella. The relationship between NirC and NO detoxification involves:

  • Coordination with Hmp (flavohemoglobin): While NirC transports nitrite, Hmp serves as the primary NO-detoxifying protein. Their activities are complementary in managing nitrosative stress .

  • Regulation by NsrR: The transcriptional regulator NsrR controls both hmp and genes involved in nitrite metabolism, ensuring coordinated expression in response to nitrosative stress .

  • Metabolic integration: Nitrite transported by NirC can be reduced to ammonia, thereby decreasing the substrate available for NO generation and indirectly reducing nitrosative stress .

Experimental data indicates that mutants lacking functional Hmp are severely compromised in macrophage survival, while NsrR mutants (which overexpress Hmp) can also be disadvantaged due to increased susceptibility to oxidative stress—demonstrating the delicate balance between nitrosative and oxidative stress responses .

How can recombinant Salmonella typhimurium expressing modified NirC be utilized as vaccine vectors?

Recombinant attenuated Salmonella typhimurium strains provide promising platforms for vaccine development due to their ability to invade host cells and deliver heterologous antigens. NirC-modified strains offer several research applications:

  • Antigen delivery systems: Recombinant S. typhimurium can express foreign antigens for delivery to the immune system, with modifications to NirC potentially enhancing bacterial persistence in specific tissues .

  • Balanced-lethal vector-host systems: These ensure plasmid stability without antibiotic selection markers, critical for vaccine development. Modified NirC expression can be incorporated into these systems to enhance immune responses .

  • Attenuated vaccine strains: Strategic modifications to NirC expression can be used to attenuate virulence while maintaining immunogenicity, creating safer live vaccine vectors .

Research has demonstrated that while S. typhimurium within nonphagocytic cells may be resistant to cytotoxic T lymphocyte (CTL) recognition, mice infected with recombinant S. typhimurium expressing foreign antigens can still be primed for CTL responses, indicating the potential for effective vaccination strategies .

What techniques can be employed to study the protein-protein interactions between NirC and other components of the nitrite metabolism pathway?

Understanding the protein interaction network of NirC provides insights into its regulation and functional integration within nitrite metabolism. Advanced techniques include:

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Pull-down assays using tagged NirC to identify interacting partners

    • Quantitative proteomic analysis to determine interaction dynamics under varying conditions

  • Bacterial two-hybrid screening:

    • Systematic identification of protein partners

    • Validation of direct physical interactions

  • Förster resonance energy transfer (FRET):

    • Real-time visualization of protein interactions in living bacteria

    • Quantification of interaction kinetics and spatial distribution

  • Cross-linking mass spectrometry:

    • Identification of specific interaction interfaces

    • Structural mapping of protein complexes

  • Blue native PAGE:

    • Analysis of native membrane protein complexes

    • Determination of complex stability and composition

These approaches can reveal how NirC interacts with nitrite reductases, regulators like NsrR, and other transporters in coordinating the bacterial response to nitrosative stress .

How does the Salmonella typhimurium NirC transporter compare structurally and functionally to other members of the formate-nitrite transporter family?

The NirC transporter belongs to the formate-nitrite transporter (FNT) family, which includes several related transporters across diverse microorganisms. Comparative analysis reveals:

TransporterOrganismPrimary SubstrateSecondary SubstratesRegulatory ControlStructural Features
NirCSalmonella typhimuriumNitrite-FNR, NarL, NarPIntegral membrane protein
FocAE. coli and relatedFormate-FNRPentameric channels
FdhCMethanobacterium thermoformiciumFormate---
HSCVariousHydrosulfide---

Key similarities include the transmembrane topology and channel-like properties, while differences in substrate specificity appear to be determined by specific amino acid residues within the pore region. Evolutionary analysis suggests that these transporters diverged from a common ancestor but developed specialized functions related to anaerobic metabolism in different bacterial species .

What are the key genetic differences in nirC among different Salmonella serovars and how do they impact function?

Genetic variation in nirC among Salmonella serovars can influence transporter function, regulation, and ultimately pathogenesis. Research indicates several important considerations:

  • Sequence conservation: The core functional domains of NirC are highly conserved across Salmonella serovars, reflecting its essential role in nitrite transport.

  • Regulatory region polymorphisms: Variations in promoter regions can affect expression levels and responsiveness to environmental signals like nitrate, nitrite, and oxygen tension.

  • Post-translational modifications: Differences in amino acid sequences may affect phosphorylation sites and other modifications that regulate activity.

  • Expression levels: Some serovars demonstrate higher constitutive expression of nirC, potentially correlating with adaptation to specific host environments.

Experimental approaches to studying these differences include comparative genomics, site-directed mutagenesis, and heterologous expression systems to evaluate functional impacts of specific genetic variations .

What are the current technical limitations in studying NirC transport mechanisms and how might they be overcome?

Research on NirC faces several technical challenges that limit comprehensive understanding of its transport mechanisms:

  • Membrane protein crystallization difficulties:

    • Challenge: Obtaining high-resolution structures of membrane proteins remains technically demanding

    • Solution: Advanced approaches like lipidic cubic phase crystallization, cryo-electron microscopy, and computational modeling can provide structural insights

  • Transport kinetics measurement:

    • Challenge: Real-time monitoring of nitrite transport across membranes is complicated by the lack of easily detectable signals

    • Solution: Development of nitrite-specific fluorescent probes and improved electrophysiological techniques

  • In vivo activity assessment:

    • Challenge: Distinguishing NirC-specific transport from other nitrite movement mechanisms in living bacteria

    • Solution: Genetic approaches with inducible and tissue-specific expression systems combined with nitrite-specific sensors

  • Reconstitution challenges:

    • Challenge: Maintaining native function when purifying and reconstituting NirC

    • Solution: Nanodiscs and native-like membrane environments for functional studies

How might CRISPR-Cas9 gene editing be applied to study NirC function in Salmonella pathogenesis?

CRISPR-Cas9 technology offers powerful approaches for investigating NirC function in Salmonella pathogenesis:

  • Precise gene modifications:

    • Creating point mutations in key functional residues to correlate structure with function

    • Engineering regulatory element modifications to study expression control

  • Domain swapping:

    • Replacing domains between different transporter family members to identify functional regions

    • Creating chimeric transporters to study substrate specificity determinants

  • Reporter fusions:

    • Inserting fluorescent protein tags for real-time visualization of expression and localization

    • Creating transcriptional reporters to monitor nirC expression during infection

  • Multiplexed gene editing:

    • Simultaneously modifying nirC and related genes (e.g., nitrite reductases, regulators) to study pathway interactions

    • Creating libraries of Salmonella mutants with varying nirC modifications for high-throughput screening

  • Inducible expression systems:

    • Engineering conditional knockouts or expression systems to study temporal aspects of NirC function

    • Creating tissue-specific expression systems for in vivo studies

These approaches can provide unprecedented insights into how NirC contributes to Salmonella survival within host cells and its potential as a target for antimicrobial strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.