Recombinant Salmonella typhimurium Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzyme Structure and Catalytic Mechanism

Lgt is a membrane-bound enzyme with seven transmembrane segments. Its N-terminal domain faces the periplasm, while the C-terminal domain is cytoplasmic . Structural studies on E. coli Lgt (EcLgt) reveal a conserved Lgt signature motif (R143, E151, R239, E243) critical for substrate binding and catalysis .

Functional Role in Lipoprotein Maturation

Lgt initiates lipoprotein maturation by transferring a diacylglyceryl group to prolipoproteins, enabling membrane anchoring. This step is essential for bacterial viability and virulence.

Lipoprotein Maturation Pathway

  1. Proteolytic cleavage: Signal peptidase II (Lsp) removes the signal peptide.

  2. N-acylation: Apolipoprotein N-acyltransferase (Lnt) adds a palmitate to the α-amino group .

Salmonella lipoproteins (e.g., Lpp) contribute to virulence by modulating host immune responses . Deletion of murein lipoprotein genes (lpp1, lpp2) in S. typhimurium reduces cytokine induction (e.g., TNF-α, IL-8) and virulence .

Recombinant Systems and Mutational Analysis

Recombinant Lgt systems enable functional studies and complementation of lgt mutants.

Recombinant Lgt Expression

  • Host: E. coli BL21(DE3) or Δlgt strains .

  • Tags: His6, myc for purification and detection .

  • Activity assays: Fluorescent lipoGFP substrate or phosphatidylglycerol transfer assays .

Mutational Effects

MutationOrganismPhenotypeSource
G104S (HGGL motif)E. coliTemperature-sensitive, low activity
D249NS. typhimuriumDefective at nonpermissive temp
R143AE. coliLoss of PG-binding activity

Mutations in conserved residues (e.g., His-103, Tyr) disrupt catalysis, as shown by diethylpyrocarbonate (DEPC) inactivation studies .

Role in Virulence and Pathogenicity

Lipoproteins are key virulence factors in Salmonella. Lgt-mediated modification ensures proper localization and function of these proteins.

Virulence Implications

  • Immune evasion: Lipoproteins modulate TLR2 signaling, reducing cytokine responses in hosts .

  • Host adaptation: Pseudogene accumulation in livestock-associated S. typhimurium clades suggests metabolic adaptation .

Applications in Research and Vaccine Development

While not directly studied in S. typhimurium, recombinant Lgt systems inform vaccine design and antibiotic targeting.

Potential Applications

  1. Antibiotic development: Targeting Lgt’s conserved catalytic residues (e.g., His-103) for broad-spectrum inhibitors.

  2. Vaccine engineering: Modifying lipoprotein expression to enhance immunogenicity .

Research Gaps and Future Directions

  1. Structural studies: Crystallography of S. typhimurium Lgt to confirm homology with EcLgt.

  2. Host-pathogen interactions: Role of Lgt in S. typhimurium persistence and transmission.

References

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please specify them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us. We will prioritize the development of the specified tag.
Synonyms
lgt; STM3002; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPDFRFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: stm:STM3002

STRING: 99287.STM3002

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the basic function of prolipoprotein diacylglyceryl transferase (Lgt) in Salmonella typhimurium?

Prolipoprotein diacylglyceryl transferase (Lgt) in Salmonella typhimurium catalyzes the first step in the lipoprotein modification pathway. Specifically, Lgt transfers an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine in the lipobox motif of prolipoproteins, forming a thioether linkage. This reaction results in diacylglyceryl-prolipoprotein and glycerolphosphate as a by-product . This modification is critical for the proper anchoring of lipoproteins to the bacterial membrane and is part of a three-enzyme sequential process that includes Lgt, signal peptidase II (Lsp), and apolipoprotein N-acyltransferase (Lnt) .

  • How does the structure of Salmonella typhimurium Lgt compare to Lgt in other bacterial species?

Sequence analysis reveals that Salmonella typhimurium Lgt shares significant homology with Lgt proteins from other Gram-negative bacteria. Specifically, comparative studies show that S. typhimurium Lgt has approximately 24% identity and 47% similarity with the Lgt proteins from Escherichia coli, Haemophilus influenzae, and Staphylococcus aureus . Despite being from phylogenetically distant bacterial species, these Lgt proteins share conserved amino acid sequences throughout the molecule, particularly the H-103-GGLIG-108 motif, which is the longest set of identical amino acids without any gap in these four microorganisms . This conservation suggests functional preservation of the enzyme across diverse bacterial species.

  • What are the structural characteristics of Salmonella typhimurium Lgt protein?

Salmonella typhimurium Lgt is a membrane-bound protein consisting of 291 amino acids. According to topology studies performed on the homologous E. coli Lgt, the protein is embedded in the membrane by seven transmembrane segments, with its N-terminus facing the periplasm and its C-terminus facing the cytoplasm . The amino acid sequence includes highly conserved regions that are critical for function, including the Lgt signature motif which faces the periplasm. The protein contains several invariant residues (such as Y26, N146, and G154 in E. coli) that are absolutely required for Lgt function, and other important residues (R143, E151, R239, and E243) that significantly impact activity . These structural features are likely conserved in S. typhimurium Lgt given the high degree of sequence similarity.

  • What methods are commonly used to express and purify recombinant Salmonella typhimurium Lgt?

Expression and purification of recombinant Salmonella typhimurium Lgt typically involves:

  • Cloning: The lgt gene (STM3002) is PCR-amplified from S. typhimurium genomic DNA and cloned into an appropriate expression vector, such as pET or pBAD series vectors.

  • Expression systems: Due to its membrane-bound nature, Lgt is often expressed in E. coli host strains optimized for membrane protein expression (e.g., C41/C43 or BL21(DE3) derivatives).

  • Solubilization: Since Lgt is a membrane protein, detergent solubilization is required. n-Dodecyl β-D-maltoside (DDM) at a concentration of 0.02% has been used successfully for E. coli Lgt and is likely suitable for S. typhimurium Lgt.

  • Purification strategies:

    • Affinity chromatography: Using His-tagged or biotinylated Lgt for purification with Ni-NTA or streptavidin resin, respectively .

    • Size exclusion chromatography: To enhance purity and separate protein from detergent micelles.

  • Storage: Purified protein is typically stored in a buffer containing 50 mM Tris (pH 8), 200 mM NaCl, detergent, and often glycerol (up to 50%) to maintain stability .

These methods require optimization depending on the specific research application and desired yield/purity requirements.

Advanced Research Questions

  • How can I design an in vitro assay to measure Salmonella typhimurium Lgt enzymatic activity?

To design an in vitro assay for measuring S. typhimurium Lgt enzymatic activity, you can adapt the glycerol phosphate release assay previously used for E. coli Lgt . This assay measures the release of glycerol phosphate, which is a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate.

Materials required:

  • Purified recombinant S. typhimurium Lgt

  • Phosphatidylglycerol substrate (containing racemic glycerol moiety)

  • Synthetic peptide substrate derived from Pal lipoprotein (Pal-IAAC, where C is the conserved cysteine)

  • Detergent (e.g., 0.02% DDM) to maintain Lgt solubility

Detection method:
A coupled luciferase reaction can be used to detect glycerol-3-phosphate (G3P) released during the reaction. Since the phosphatidylglycerol substrate contains a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and G3P are released .

Assay protocol:

  • Prepare reaction mixture containing Lgt, phosphatidylglycerol, and peptide substrate in appropriate buffer

  • Incubate at 37°C for a defined time period

  • Detect G3P using the coupled luciferase reaction

  • Quantify the signal and calculate enzymatic activity

Controls:

  • Negative control: Reaction without Lgt or with heat-inactivated Lgt

  • Positive control: Known Lgt from E. coli with established activity

  • Substrate specificity controls: Different peptide substrates or modified phospholipids

This assay can be used to assess inhibitors, study structure-function relationships, or compare Lgt activities across different bacterial species.

  • What are the implications of Lgt inhibition for Salmonella typhimurium virulence, and how can this be experimentally validated?

Lgt inhibition would likely significantly impact S. typhimurium virulence based on studies with lipoprotein gene (lpp) knockout mutants. The implications include:

Potential virulence effects:

  • Reduced invasive ability in epithelial cells

  • Decreased cytotoxicity in host cells

  • Impaired motility despite normal flagella production

  • Diminished induction of proinflammatory cytokines (TNF-α, IL-8)

  • Attenuated virulence in mouse models

Experimental validation approaches:

  • In vitro cell culture models:

    • Invasion assays using T84 intestinal epithelial cells, comparing wild-type, Lgt inhibitor-treated, and lgt mutant strains

    • Cytotoxicity assays using LDH release from RAW264.7 macrophages and T84 cells

    • Motility assays on semi-solid agar

    • Proinflammatory cytokine induction assays measuring TNF-α and IL-8 production

  • In vivo mouse models:

    • Mouse model of salmonellosis using both immunocompetent mice and SCID mice

    • Parameters to measure: bacterial burden in tissues, mouse survival, inflammatory markers

  • Controls required:

    • Wild-type S. typhimurium strain (positive control)

    • Defined lgt knockout mutant (comparative control)

    • Complemented lgt mutant (restoration control)

    • Strains with other virulence genes inactivated (specificity controls)

This comprehensive experimental approach would provide robust validation of Lgt's role in S. typhimurium virulence and the potential of Lgt inhibitors as therapeutic agents.

  • How does the deletion of lgt affect the global lipoprotein profile of Salmonella typhimurium, and what methods can be used to characterize these changes?

The deletion of lgt in Salmonella typhimurium would significantly alter the global lipoprotein profile, likely preventing proper membrane localization of multiple lipoproteins. To characterize these changes, the following methodological approaches can be employed:

1. Triton X-114 phase separation:

  • This technique separates hydrophobic (lipid-modified) and hydrophilic (unmodified) proteins

  • Expected result: Lipoproteins from lgt mutants would predominantly partition in the aqueous phase rather than the detergent phase, indicating lack of lipid modification

2. Mass spectrometry-based approaches:

  • Comparative lipidomics using LC-MS/MS to identify and quantify modified vs. unmodified prolipoproteins

  • MALDI-TOF analysis of tryptic peptides to detect the presence/absence of diacylglyceryl modifications

3. Immunological techniques:

  • Western blotting of Triton X-114 extracts using antibodies against specific lipoproteins (e.g., Lpp, Pal)

  • Flow cytometry to quantify surface-displayed lipoproteins

  • Immunofluorescence microscopy to visualize changes in lipoprotein localization

4. Functional assays for lipoprotein-dependent processes:

  • Cation transport assays (zinc uptake, sensitivity to cation depletion)

  • Carbon source utilization (growth curves with different substrates)

  • Stress response tests (oxidative stress sensitivity)

A systematic analysis using these methods would provide comprehensive insights into how lgt deletion affects the proteome, membrane composition, and functional capabilities of S. typhimurium.

  • What are the critical residues for Salmonella typhimurium Lgt function, and how can site-directed mutagenesis be used to validate their importance?

Based on comparative studies with E. coli Lgt, several highly conserved residues are likely critical for S. typhimurium Lgt function. These can be validated through site-directed mutagenesis using the following approach:

Critical residues predicted from sequence alignment:

  • Y26, N146, G154: Absolutely required for Lgt function in E. coli

  • R143, E151, R239, E243: Important for optimal activity

  • H-103-GGLIG-108 motif: The longest completely conserved sequence across multiple bacterial species

Site-directed mutagenesis protocol:

  • Primer design:

    • Design complementary synthetic oligonucleotides containing the desired mutation

    • Include appropriate restriction sites for screening

  • PCR amplification:

    • Use a two-step PCR based on the QuickChange site-directed mutagenesis protocol

    • Use wild-type S. typhimurium lgt as template

  • Transformation and screening:

    • Transform the PCR product into a suitable E. coli strain

    • Screen transformants by restriction digestion and confirm by sequencing

  • Functional validation:

    • Express and purify the mutant proteins

    • Assess enzymatic activity using the glycerol phosphate release assay

    • Perform complementation assays using an lgt depletion strain

Expected results table:

MutationExpected Effect on Enzymatic ActivityExpected Effect on Complementation
Y26AComplete lossNo growth restoration
N146AComplete lossNo growth restoration
G154AComplete lossNo growth restoration
R143APartial reductionDelayed/reduced growth
E151APartial reductionDelayed/reduced growth
R239APartial reductionDelayed/reduced growth
E243APartial reductionDelayed/reduced growth
G104SSignificant reductionTemperature-sensitive growth

This systematic mutagenesis approach would provide crucial insights into the structure-function relationship of S. typhimurium Lgt.

  • How can novel inhibitors of Salmonella typhimurium Lgt be identified and characterized?

The identification and characterization of novel Salmonella typhimurium Lgt inhibitors can be approached through several complementary strategies:

1. High-throughput screening approaches:

  • Adaptation of the glycerol phosphate release assay to a 384-well format for screening compound libraries

  • Use of RNase P RNA-based fluorescence assays to detect accumulation of unprocessed prolipoproteins

  • Cell-based reporter systems that detect cell envelope stress responses, such as the rcsA promoter GFP reporter system

2. Structure-based design:

  • While no crystal structure of S. typhimurium Lgt exists, homology modeling based on related proteins can guide rational design

  • In silico docking studies to identify potential binding sites and scaffold molecules

3. Affinity-based selection:

  • Affinity selection of macrocyclic peptides binding to Lgt using mRNA display technology, as demonstrated for E. coli Lgt

  • Protocol: Prepare biotinylated Lgt in 0.02% DDM, perform selection with peptide-mRNA fusion library, isolate binders using streptavidin-coated beads, and identify candidates through next-generation sequencing

4. Characterization of identified inhibitors:

a) Biochemical characterization:

  • IC50 determination using the enzymatic assay

  • Mechanism of inhibition (competitive, non-competitive, uncompetitive)

  • Specificity against other related enzymes

b) Cellular effects:

  • Minimum inhibitory concentration (MIC) against S. typhimurium

  • Cell envelope integrity assessment

  • Accumulation of unmodified prolipoproteins

c) In vivo evaluation:

  • Efficacy in mouse models of salmonellosis

  • Pharmacokinetic and toxicity studies

Example inhibitors from E. coli studies:
The macrocyclic peptides G9066, G2823, and G2824 were identified as potent inhibitors of E. coli Lgt with IC50 values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively . These could serve as starting points for S. typhimurium Lgt inhibitor development.

  • How does the presence of two copies of the lpp gene in Salmonella typhimurium affect Lgt function and bacterial virulence?

Salmonella typhimurium possesses two highly homologous copies of the murein lipoprotein genes (lpp1 and lpp2) located in tandem in the genome. The relationship between these duplicate genes and Lgt function has several important implications:

Impact on Lgt function:

  • Both Lpp1 and Lpp2 are substrates for Lgt-mediated lipid modification

  • The presence of two lpp genes may indicate higher Lpp production needs, potentially affecting Lgt substrate load

  • While Lgt modifies various prolipoproteins, Lpp is one of the most abundant substrates, representing a significant portion of Lgt's functional output

Virulence implications:
Studies with lpp gene knockout mutants have revealed:

  • Single knockout mutants (Δlpp1 or Δlpp2) were avirulent in mice, similar to the double-knockout (Δlpp1Δlpp2) mutant

  • The Δlpp double-knockout mutant showed:

    • Reduced invasion of T84 intestinal epithelial cells by 500-1000 fold

    • Decreased cytotoxicity in both T84 and RAW264.7 cells (~80% reduction)

    • Impaired motility despite normal flagella numbers

    • Significantly decreased production of proinflammatory cytokines (TNF-α, IL-8)

    • Complete avirulence in immunocompetent mice but maintained virulence in SCID mice

Experimental evidence:
The relationship between lpp genes and Lgt function can be assessed by measuring Lgt activity under different conditions:

  • Compare Lgt enzymatic activity against synthetic Lpp1 vs. Lpp2 peptide substrates

  • Assess Lgt expression levels in wild-type vs. Δlpp1 or Δlpp2 single mutants

  • Evaluate the complementation effect of expressing Lgt in lpp mutant backgrounds

Significance:
Understanding the interaction between Lgt and the dual lpp genes in S. typhimurium provides insights into bacterial adaptation strategies and potential targets for therapeutic intervention. The reduced virulence of lpp mutants suggests that inhibition of Lgt could significantly impair S. typhimurium pathogenicity by preventing proper Lpp modification.

Methodology-Focused Questions

  • What are the key considerations for constructing a complementation system to validate Salmonella typhimurium lgt mutant phenotypes?

Constructing an effective complementation system for S. typhimurium lgt mutants requires careful consideration of several factors to ensure proper validation of phenotypes:

Vector selection:

  • Low to medium copy number plasmids (e.g., pAM238 or pBAD18) are preferable to avoid overexpression artifacts

  • Temperature-stable vectors for in vivo experiments

  • Vectors compatible with S. typhimurium (e.g., pJQ200SK has been used successfully)

Promoter considerations:

  • Native promoter: For physiological expression levels

  • Inducible promoter (e.g., arabinose-inducible pBAD or IPTG-inducible): For controlled expression

  • Constitutive promoter: For continuous expression

Construct design:

  • Include the entire lgt gene with its native ribosome binding site

  • Consider adding epitope tags (e.g., c-myc) for detection, but validate functionality of tagged protein

  • Include appropriate selectable markers compatible with S. typhimurium

Validation requirements:

  • Expression verification:

    • Western blot analysis to confirm Lgt protein production

    • qRT-PCR to verify transcript levels

  • Functional verification:

    • Western blot analysis using anti-Lpp antibodies to confirm restoration of Lpp modification

    • Triton X-114 phase separation to assess lipoprotein membrane localization

  • Phenotypic verification:

    • Invasion assays with epithelial cells

    • Motility assays

    • Cytotoxicity assays

    • Cytokine induction tests

    • In vivo virulence assessment

Controls to include:

  • Empty vector control

  • Wild-type strain with same vector

  • Partial complementation (e.g., single lpp gene in a double mutant)

  • Complementation with mutated versions of lgt (for structure-function studies)

This comprehensive complementation approach ensures that observed phenotypes are specifically attributed to lgt function, providing validation for research findings.

  • How does temperature affect the enzymatic activity of Salmonella typhimurium Lgt, and what methods can be used to assess temperature sensitivity?

The enzymatic activity of Salmonella typhimurium Lgt is significantly influenced by temperature, as indicated by studies of temperature-sensitive lgt mutants from E. coli and S. typhimurium . Understanding this relationship requires specialized methods:

Temperature effects on Lgt activity:

  • Optimal activity range:

    • S. typhimurium Lgt likely functions optimally around 37°C, corresponding to the bacterium's preferred growth temperature

    • Activity decreases at lower temperatures (20-30°C) and is likely compromised at higher temperatures (>42°C)

  • Known temperature-sensitive mutations:

    • The G104S mutation in the conserved H-103-GGLIG-108 motif of E. coli Lgt renders the enzyme temperature-sensitive

    • Similar mutations likely produce comparable effects in S. typhimurium Lgt

Methods to assess temperature sensitivity:

  • In vitro enzymatic assays:

    • Perform the glycerol phosphate release assay at different temperatures (25°C, 30°C, 37°C, 42°C)

    • Calculate enzyme kinetic parameters (Km, Vmax, kcat) at each temperature

    • Construct Arrhenius plots to determine activation energy

  • Thermal stability assays:

    • Differential scanning fluorimetry (DSF) to determine melting temperature (Tm)

    • Circular dichroism (CD) spectroscopy to monitor secondary structure changes with temperature

    • Limited proteolysis at various temperatures to assess conformational stability

  • Cell-based functional assays:

    • Growth curves of wild-type and lgt mutant strains at different temperatures

    • Western blot analysis of lipoprotein modification at various temperatures

    • Temperature shift experiments to identify reversible vs. irreversible effects

Experimental design for temperature sensitivity studies:

TemperatureWild-type Lgt ActivityTemperature-sensitive Mutant ActivityExpected Phenotypic Effects
25°CReduced but functionalFunctionalMinimal growth differences
30°CNear optimalFunctionalMinimal growth differences
37°COptimalPartially functionalModerate growth defect in mutant
42°CSlightly reducedSeverely impairedSignificant growth arrest in mutant

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.