Recombinant Salmonella typhimurium Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

As a recombinant protein, HtpX is typically produced with specific tags to facilitate purification, though the tag type may vary based on production methods . The recommended storage conditions for the purified recombinant protein include a Tris-based buffer with 50% glycerol at -20°C, with -80°C suggested for extended storage periods . Repeated freeze-thaw cycles are not recommended, and working aliquots can be stored at 4°C for up to one week .

PropertyCharacteristic
Protein TypeRecombinant Protein
SpeciesSalmonella typhimurium (strain LT2/SGSC1412/ATCC 700720)
UniProt AccessionP65817
Enzyme ClassificationEC 3.4.24.- (Metalloprotease)
Gene NamehtpX
LocusSTM1844
Expression Region1-293
Storage BufferTris-based buffer, 50% glycerol
Recommended Storage-20°C (short term), -80°C (long term)

Heat Shock Protein Function

The "HtpX" designation reflects its classification as a Heat shock protein, a family of proteins typically upregulated during environmental stress conditions. While direct evidence for HtpX in Salmonella is limited in the available research, studies on related bacterial heat shock proteins demonstrate their importance in managing cellular stress. For example, in Stenotrophomonas maltophilia, htpX gene expression increases significantly in response to aminoglycoside exposure, suggesting a role in stress adaptation .

Heat shock proteins generally function as molecular chaperones or proteases that help maintain protein homeostasis under adverse conditions. In this context, HtpX likely participates in the degradation of misfolded or damaged membrane proteins, thereby preserving cellular integrity during stress.

Protease Activity Mechanisms

As a metalloprotease, HtpX catalyzes the hydrolysis of peptide bonds using a metal ion (typically zinc) in its active site. The enzyme's designation (EC 3.4.24.-) identifies it as a zinc-dependent metallopeptidase that cleaves internal peptide bonds in substrate proteins . This proteolytic activity enables HtpX to degrade misfolded membrane proteins that could otherwise accumulate and become toxic to the cell.

While the specific substrates of Salmonella typhimurium HtpX remain to be fully characterized, research on homologous proteins suggests it likely targets membrane proteins that have become damaged due to heat, oxidative stress, or other environmental challenges.

Expression Systems

The production of Recombinant Salmonella typhimurium Protease HtpX typically involves cloning the htpX gene into expression vectors, followed by transformation into suitable host cells. While the specific expression system for commercial production may vary, common approaches involve using E. coli or related bacterial hosts equipped with inducible promoters to control protein expression.

Drawing from methodologies described for similar recombinant proteases, the process often includes PCR amplification of the htpX gene from Salmonella typhimurium genomic DNA, incorporation into vectors containing appropriate restriction sites, and transformation into expression hosts . For instance, research on related bacterial proteases has utilized primers containing recognition sites for restriction endonucleases like BamHI and SmaI to facilitate cloning .

Purification Strategies

Purification of Recombinant HtpX typically involves a series of chromatographic techniques designed to isolate the protein with high purity. The process may include:

  1. Cell lysis to release the expressed protein

  2. Initial clarification steps to remove cellular debris

  3. Affinity chromatography utilizing tags engineered into the recombinant protein

  4. Additional purification steps such as ion exchange or size exclusion chromatography

  5. Final concentration and buffer exchange to optimize storage conditions

The purified recombinant protein is then formulated in a suitable buffer (typically Tris-based with 50% glycerol) to maintain stability during storage . Quality control steps include verification of protein identity and purity through techniques such as SDS-PAGE and mass spectrometry.

Comparison with Other Heat Shock Proteins

While direct evidence for HtpX's role in Salmonella pathogenesis is limited in the available research, insights can be drawn from studies on related heat shock proteins. For instance, research on HtpG (another heat shock protein in Salmonella Typhimurium) has demonstrated its involvement in bacterial infection processes .

HtpG functions as a molecular chaperone and plays roles in various cellular processes, particularly under environmental stress conditions . RNA-sequencing studies have shown that HtpG influences the expression of genes involved in flagellar assembly, infection pathways, and chemotaxis, ultimately affecting S. Typhimurium motility, biofilm formation, adhesion, invasion, and inflammation-inducing abilities .

Implications for Bacterial Survival and Virulence

Given the importance of protein quality control during infection, HtpX may contribute to Salmonella pathogenesis by enabling the bacterium to maintain membrane integrity while adapting to host environments. The stress conditions encountered during infection—including elevated temperatures, pH changes, and host defense mechanisms—likely necessitate functional proteases like HtpX to manage damaged proteins.

In related bacterial species, proteases with functions similar to HtpX have been implicated in antibiotic resistance mechanisms. For example, in Stenotrophomonas maltophilia, both ClpA and HtpX proteases contribute to intrinsic aminoglycoside resistance . Inactivation of these proteases compromises this resistance mechanism, highlighting their potential significance as targets for therapeutic intervention .

Research Applications

Commercially available Recombinant Salmonella typhimurium Protease HtpX serves as a valuable tool for various research applications . These include:

  1. Investigating protein-protein interactions involving HtpX

  2. Studying the enzyme's proteolytic activity and substrate specificity

  3. Developing and testing potential inhibitors as candidate antimicrobials

  4. Generating antibodies for detection and localization studies

  5. Structural biology investigations to elucidate the protein's three-dimensional configuration

The availability of purified recombinant HtpX allows researchers to conduct controlled in vitro experiments that would be challenging or impossible using native protein from bacterial cultures.

Diagnostic Potential

While not currently established as a diagnostic target, HtpX has potential applications in Salmonella detection methodologies. The development of antibodies specific to this protease could potentially contribute to immunoassays for detecting Salmonella typhimurium in clinical or environmental samples. Additionally, nucleic acid-based detection methods targeting the htpX gene could provide specific identification of this bacterial pathogen.

Domain Organization

Based on comparative analysis with related proteases, HtpX likely contains an M48 peptidase domain characteristic of zinc metalloproteases . This domain typically includes the zinc-binding motif essential for catalytic activity. While the specific domain organization of Salmonella typhimurium HtpX is not directly detailed in the available research, structurally related proteases feature transmembrane segments that anchor the protein in the membrane, with the active site positioned to access substrate proteins.

Tertiary Structure Predictions

Tertiary structure predictions for related proteases suggest that HtpX likely includes multiple α-helices, β-strands, and connecting regions that form the active site and substrate binding pockets. For instance, structural modeling of a related htpX protease (DX-3-htpX) revealed a complex architecture comprising "ten α-helixes, four strands, two 310 helixes, twelve turns, seven bends, and multiple coil" structures .

Advanced computational methods like AlphaFold have been employed to predict the three-dimensional structures of similar proteases, with subsequent analysis of binding pockets and metal ion interactions performed using specialized software like CASTpFold . These approaches could similarly be applied to gain insights into the structure-function relationships of Salmonella typhimurium HtpX.

HtpX and Antibiotic Responses

Research on related bacterial species has demonstrated connections between HtpX and responses to antibiotic exposure. In Stenotrophomonas maltophilia, the htpX gene is upregulated following exposure to kanamycin, an aminoglycoside antibiotic . Moreover, genetic studies have identified HtpX as one of the primary determinants responsible for intrinsic aminoglycoside resistance in this bacterium .

While direct evidence for a similar role in Salmonella typhimurium is not provided in the available research, these findings suggest potential conservation of function across different bacterial species. If Salmonella HtpX similarly contributes to antibiotic resistance mechanisms, it could represent a valuable target for developing adjuvant therapies aimed at enhancing antibiotic efficacy.

Potential as a Therapeutic Target

The involvement of HtpX in stress response and potentially in antibiotic resistance makes it an intriguing candidate for therapeutic intervention. Inactivation of htpX in Stenotrophomonas maltophilia has been shown to compromise protease-mediated intrinsic aminoglycoside resistance and weaken pump-mediated resistance mechanisms . This observation suggests that inhibitors targeting HtpX could potentially serve as adjuvants to enhance the efficacy of existing antibiotics against resistant bacteria.

The development of such inhibitors would require detailed structural knowledge of the enzyme's active site and catalytic mechanism. Recombinant HtpX provides a valuable tool for such investigations, enabling high-throughput screening of potential inhibitors and structure-activity relationship studies.

Gene Regulation Studies

Understanding the regulation of htpX expression in Salmonella typhimurium represents an important area for future investigation. While research on related bacteria has shown upregulation in response to stress conditions and antibiotic exposure , the specific regulatory mechanisms controlling htpX expression in Salmonella remain to be fully elucidated. Studies examining promoter regions, transcription factors, and environmental signals that modulate htpX expression would provide valuable insights into the protein's physiological roles.

Functional Characterization

Further functional characterization of HtpX in Salmonella typhimurium is needed to definitively establish its roles in stress response, protein quality control, and potentially in pathogenesis. Approaches might include:

  1. Generation and characterization of htpX deletion mutants

  2. Transcriptomic and proteomic analyses to identify affected pathways

  3. Identification of specific protein substrates of HtpX proteolytic activity

  4. Investigation of potential roles in biofilm formation and host cell interactions

  5. Assessment of contributions to antibiotic resistance mechanisms

Such studies would significantly enhance our understanding of this important bacterial protease and potentially reveal new avenues for therapeutic intervention.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; STM1844; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
htpX
Target Protein Sequence
MMRIALFLLTNLAVMVVFGLVLSLTGIQSSSVQGLLIMALLFGFGGSFISLLMSKWMALK SVGGEVIEQPRNERERWLMNTVATQARQAGIAMPQVAIYHAPDINAFATGARRDASLVAV STGLLQNMSPDEAEAVIAHEISHIANGDMVTMTLIQGVVNTFVIFISRIIAQIAAGFLGG NRDEGEGSNGNPLIYFAVATVLELVFGILASIITMWFSRYREFHADAGSAKLVGREKMIA ALQRLKTSYEPQEATSMMAFCINGKSKSLSELFMTHPPLDKRIEALRSGEYLK
Uniprot No.

Target Background

Database Links

KEGG: stm:STM1844

STRING: 99287.STM1844

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX and what is its general function in bacterial cells?

HtpX is a membrane-bound zinc metalloprotease that plays a critical role in protein quality control and stress response mechanisms in bacteria. This protease is responsible for degrading misfolded or damaged membrane proteins, helping to maintain cellular homeostasis under stress conditions. In bacteria such as Stenotrophomonas maltophilia, htpX genes are upregulated in response to aminoglycoside exposure, indicating their importance in bacterial stress adaptation . HtpX functions as part of the protein quality control system that prevents the accumulation of potentially toxic misfolded proteins, particularly under antibiotic stress conditions.

The protease activity of HtpX is especially important when bacteria encounter environmental stressors such as antibiotics, temperature fluctuations, or host immune defenses. By removing damaged proteins from the membrane, HtpX helps maintain membrane integrity and cellular function, contributing to bacterial survival during infection and antibiotic exposure.

How does HtpX differ structurally and functionally from other bacterial proteases?

HtpX belongs to a distinct class of membrane-bound proteases that differs significantly from cytoplasmic proteases like the Clp system:

ProteaseLocationStructureFunctionResponse to Kanamycin
HtpXMembrane-boundZinc metalloprotease with transmembrane domainsDegradation of misfolded membrane proteinsUpregulated
ClpACytoplasmicATP-dependent AAA+ ATPaseSubstrate recognition and unfolding for ClpPUpregulated
ClpPCytoplasmicSerine protease, forms proteolytic coreDegradation of unfolded proteinsUpregulated
ClpSCytoplasmicAdaptor proteinModulates ClpA substrate specificityUpregulated
ClpXCytoplasmicATP-dependent AAA+ ATPaseAlternative partner for ClpPNot significantly upregulated

While the Clp system operates primarily on cytoplasmic proteins, HtpX specifically targets membrane proteins. Both systems contribute to aminoglycoside resistance but through different mechanisms. In S. maltophilia, inactivation of clpA and htpX compromised protease-mediated intrinsic aminoglycoside resistance and weakened SmeYZ pump-mediated aminoglycoside resistance, indicating their complementary roles in antibiotic resistance .

What experimental techniques are essential for producing functional recombinant HtpX?

Producing functional recombinant HtpX presents unique challenges due to its membrane-bound nature. Successful expression requires careful consideration of expression systems, solubilization methods, and activity verification:

  • Gene cloning strategies:

    • PCR amplification of the htpX gene from S. typhimurium genomic DNA

    • Cloning into appropriate expression vectors with affinity tags

    • Verification of construct integrity through sequencing

  • Expression systems optimization:

    • E. coli strains specialized for membrane protein expression

    • Induction conditions (temperature, inducer concentration, duration)

    • Membrane fraction isolation through differential centrifugation

  • Protein solubilization and purification:

    • Detergent screening for optimal solubilization

    • Affinity chromatography using His-tag or other fusion tags

    • Size exclusion chromatography for final purification

  • Activity verification:

    • Protease activity assays using fluorogenic substrates

    • Verification of proper folding through circular dichroism

    • Western blot analysis to confirm protein identity and purity

Researchers must optimize each of these steps to obtain functionally active recombinant HtpX, as improper expression or purification can result in inactive enzyme or protein aggregation.

How is the htpX gene regulated in response to environmental stresses?

While direct information on htpX regulation in S. typhimurium is limited in the provided sources, insights can be drawn from related bacterial systems. In S. maltophilia, htpX is significantly upregulated in response to kanamycin exposure, alongside other protease genes including clpA, clpS, and clpP . This upregulation suggests regulation by stress-responsive pathways that detect and respond to antibiotic-induced cellular damage.

The regulation of stress-responsive proteases typically involves:

  • Sigma factor-dependent transcription: Alternative sigma factors that respond to specific stresses may direct RNA polymerase to the htpX promoter

  • Two-component signaling systems: Membrane-associated sensor kinases detect environmental stresses and activate response regulators that modulate gene expression

  • Global stress regulators: Regulatory proteins that coordinate cellular responses to various stresses may influence htpX expression

  • Post-transcriptional regulation: mRNA stability and translation efficiency may be regulated in response to stress conditions

Understanding the specific regulatory mechanisms controlling htpX expression in S. typhimurium would provide valuable insights into bacterial stress adaptation and potential targets for therapeutic intervention.

What are the key phenotypic differences between wild-type and htpX mutant S. typhimurium strains?

Based on research with related bacterial proteases and stress response systems, htpX mutation in S. typhimurium would likely produce several observable phenotypic differences:

  • Antibiotic susceptibility: Increased sensitivity to aminoglycosides and potentially other antibiotics, similar to observations in S. maltophilia where htpX mutation compromised intrinsic aminoglycoside resistance

  • Stress tolerance: Reduced survival under conditions that cause protein misfolding, such as heat shock, oxidative stress, or membrane-disrupting agents

  • Membrane protein homeostasis: Accumulation of misfolded membrane proteins, potentially affecting membrane integrity and function

  • Virulence characteristics: Potentially altered virulence properties similar to those observed with HtpG mutation in S. typhimurium, which affected "flagellar assembly pathway, infection pathway, and chemotaxis pathway genes"

  • Biofilm formation: Possibly reduced capacity to form biofilms, as observed with HtpG mutation in S. typhimurium

Systematic characterization of these phenotypic differences would provide crucial insights into HtpX function and its potential as a therapeutic target.

How does HtpX contribute to aminoglycoside resistance mechanisms in S. typhimurium?

HtpX likely contributes to aminoglycoside resistance in S. typhimurium through multiple mechanisms, based on findings from S. maltophilia research:

  • Protein quality control: Aminoglycosides cause mistranslation and production of aberrant proteins. HtpX helps degrade these misfolded proteins, reducing their toxic effects and enabling bacterial survival .

  • Membrane integrity maintenance: By removing damaged membrane proteins, HtpX helps preserve membrane integrity, potentially reducing drug uptake and enhancing bacterial survival during antibiotic exposure.

  • Efflux pump function support: In S. maltophilia, HtpX inactivation weakened SmeYZ pump-mediated aminoglycoside resistance , suggesting that HtpX may support the function of efflux systems either directly or indirectly.

  • Stress response coordination: HtpX appears to be part of a coordinated stress response involving multiple proteases (ClpA, ClpP, ClpS) , creating a robust defense against antibiotic-induced damage.

Research has identified HtpX as a potential aminoglycoside adjuvant target , suggesting that inhibiting this protease could enhance antibiotic efficacy against resistant bacteria. This finding highlights HtpX's significance in bacterial antibiotic resistance mechanisms.

What methodologies are most effective for identifying HtpX substrates in vivo?

Identifying physiological substrates of HtpX requires sophisticated methodological approaches:

  • Comparative proteomics:

    • Quantitative comparison of membrane protein profiles between wild-type and htpX mutant strains

    • Identification of proteins that accumulate in the absence of HtpX

    • SILAC or TMT labeling for precise quantification of protein abundance changes

  • Substrate trapping approaches:

    • Generation of catalytically inactive HtpX variants (e.g., by mutating the zinc-binding motif)

    • Identification of proteins that bind but are not degraded

    • Crosslinking followed by mass spectrometry to identify interaction partners

  • In vivo degradation assays:

    • Pulse-chase experiments with radioisotope labeling

    • Monitoring stability of candidate substrates in wild-type versus htpX mutant backgrounds

    • Reconstitution of degradation with purified components to confirm direct activity

  • Bioinformatic prediction and validation:

    • Computational analysis of potential degradation motifs

    • Screening of predicted substrates through targeted assays

    • Validation using in vitro degradation assays with purified components

These approaches can be combined to build a comprehensive understanding of HtpX substrate specificity and its physiological functions in S. typhimurium.

How does HtpX function intersect with bacterial pathogenicity and virulence mechanisms?

The relationship between HtpX and S. typhimurium virulence likely involves several interconnected pathways:

  • Stress adaptation during host infection: Drawing parallels from HtpG studies in S. typhimurium, where mutation affected "motility, biofilm formation, adhesion, invasion, and inflammation-inducing ability" , HtpX may similarly support virulence by enabling adaptation to host-associated stresses.

  • Virulence gene expression: Protein quality control systems like HtpX may indirectly influence virulence gene expression by affecting membrane protein turnover and signaling pathway function.

  • Intracellular survival: S. typhimurium must survive within host cells during infection. Studies with HtpG showed that its mutation reduced intracellular proliferation in both epithelial cells and macrophages . HtpX may play a similar role in supporting intracellular survival.

  • Biofilm formation: HtpX might influence biofilm formation, a key virulence trait that was compromised in HtpG mutants . The ability to form biofilms contributes to antibiotic resistance and persistence during infection.

  • Inflammatory response modulation: HtpG mutation in S. typhimurium reduced inflammation-inducing ability , and HtpX might similarly affect host-pathogen interactions through its protein quality control functions.

Understanding these intersections would provide valuable insights into bacterial pathogenesis and potential therapeutic targets.

What is the structural basis for HtpX substrate recognition and proteolytic activity?

Understanding the structural determinants of HtpX function requires detailed structural and biochemical studies:

  • Substrate recognition mechanisms:

    • Identification of specific sequence motifs or structural features recognized by HtpX

    • Mapping of substrate binding sites through mutagenesis and interaction studies

    • Determination of how misfolded proteins are distinguished from properly folded ones

  • Catalytic mechanism:

    • Role of the zinc-binding motif (HEXXH) in coordinating the catalytic zinc ion

    • Identification of residues involved in substrate binding and catalysis

    • Elucidation of the proteolytic mechanism through structural and biochemical approaches

  • Conformational changes during catalysis:

    • Potential movements of transmembrane domains during substrate binding and catalysis

    • Allosteric regulation of proteolytic activity

    • Energy requirements for substrate processing

  • Regulation of protease activity:

    • Mechanisms preventing inappropriate degradation of functional proteins

    • Potential for post-translational modifications affecting activity

    • Interactions with other membrane components that may modulate function

While detailed structural information for S. typhimurium HtpX is not provided in the search results, structural biology approaches including X-ray crystallography, cryo-electron microscopy, and computational modeling could provide valuable insights into these aspects of HtpX function.

How do ClpA and HtpX proteases functionally interact in aminoglycoside resistance?

The relationship between ClpA and HtpX in aminoglycoside resistance appears to be complementary and potentially synergistic:

  • Parallel stress response pathways: In S. maltophilia, both clpA and htpX were upregulated in response to kanamycin exposure , suggesting parallel activation of these proteolytic systems during antibiotic stress.

  • Distinct but complementary targets: ClpA, as part of the Clp protease system, primarily targets cytoplasmic proteins, while HtpX focuses on membrane proteins. Together, they provide comprehensive protein quality control throughout the cell.

  • Combined contribution to resistance: Inactivation of clpA and htpX compromised intrinsic aminoglycoside resistance in S. maltophilia , indicating that both proteases contribute to resistance, possibly through different mechanisms.

  • Influence on efflux pump function: Both proteases appear to support SmeYZ pump-mediated aminoglycoside resistance in S. maltophilia , suggesting they may maintain the integrity of efflux systems through protein quality control.

  • Potential for combined targeting: The identification of both HtpX and ClpA as potential aminoglycoside adjuvant targets suggests that simultaneously inhibiting both proteases might have synergistic effects on antibiotic efficacy.

Understanding the functional relationship between these proteases could lead to more effective strategies for overcoming aminoglycoside resistance in pathogenic bacteria.

What are the optimal methods for generating and characterizing htpX knockout mutants in S. typhimurium?

Creating and validating htpX knockout mutants requires careful experimental design:

  • Mutant generation strategies:

    • RED recombination system for precise gene deletion without polar effects

    • CRISPR/Cas9-based genome editing for efficient targeted mutagenesis

    • Allelic exchange using suicide vectors (similar to approaches used for S. maltophilia mutants )

  • Verification approaches:

    • PCR verification of gene deletion using primers flanking the deleted region

    • Quantitative RT-PCR to confirm absence of htpX transcription

    • Western blotting to verify absence of HtpX protein expression

    • Whole genome sequencing to confirm specificity of genetic manipulation

  • Complementation studies:

    • Reintroduction of functional htpX gene on a plasmid vector

    • Controlled expression using inducible promoters

    • Phenotypic restoration analysis to confirm that observed phenotypes are specifically due to htpX deletion

  • Strain construction considerations:

    • Creation of single mutants (ΔhtpX) for basic characterization

    • Double mutants (like ΔhtpXΔclpA) to study functional interactions between different proteases

    • Triple mutants incorporating efflux pump deletions (similar to KJΔYZΔClpAΔHtpX in S. maltophilia )

This systematic approach ensures that phenotypes can be confidently attributed to HtpX function rather than to secondary mutations or polar effects.

What experimental systems best model the role of HtpX during S. typhimurium infection?

Several experimental systems can effectively model HtpX function during infection:

  • Cellular infection models:

    • Intestinal epithelial cell lines (like IPEC-J2 used in HtpG studies )

    • Macrophage infection assays (using RAW264.7 cells as in HtpG research )

    • Quantification of bacterial adhesion, invasion, and intracellular replication

  • Animal infection models:

    • Mouse typhoid model for systemic infection

    • Streptomycin-pretreated mouse model for gastrointestinal infection

    • Competition assays comparing colonization by wild-type and htpX mutant strains

  • Biofilm models:

    • Static biofilm formation assays

    • Flow cell systems for dynamic biofilm formation under shear stress

    • Confocal microscopy analysis of biofilm architecture

  • Stress response models:

    • Antibiotic exposure experiments, particularly with aminoglycosides

    • Oxidative stress models mimicking host immune response

    • pH stress models simulating conditions in the stomach and phagosome

Each model provides different insights into HtpX function during distinct phases of infection. Comparing results across multiple models provides the most comprehensive understanding of HtpX's role in pathogenesis.

How can researchers design effective assays to measure HtpX protease activity?

Measuring HtpX protease activity requires carefully designed assays that account for its membrane-bound nature:

  • Fluorogenic substrate assays:

    • Design of peptide substrates containing recognition motifs for HtpX

    • Incorporation of fluorophore-quencher pairs that produce signal upon cleavage

    • Optimization of detergent conditions to maintain HtpX activity while enabling substrate access

  • Membrane protein substrate assays:

    • Purification of native or model membrane protein substrates

    • Monitoring degradation via SDS-PAGE, western blotting, or mass spectrometry

    • Time-course experiments to determine degradation kinetics

  • In vivo reporter systems:

    • Construction of fusion proteins containing potential HtpX cleavage sites

    • Monitoring of reporter protein levels in wild-type versus htpX mutant backgrounds

    • Inducible expression systems to control substrate levels

  • Biochemical characterization:

    • Determination of optimal pH, temperature, and ionic conditions

    • Inhibitor profiling to identify specific HtpX inhibitors

    • Kinetic analysis to determine substrate specificity and catalytic efficiency

These assays should be validated using appropriate controls, including catalytically inactive HtpX variants and known protease inhibitors, to ensure specificity and reliability of the results.

What approaches can determine HtpX's contributions to antibiotic resistance mechanisms?

Investigating HtpX's role in antibiotic resistance requires multiple complementary approaches:

  • Susceptibility testing:

    • Determination of minimum inhibitory concentrations (MICs) for various antibiotics

    • Comparison of wild-type, htpX mutant, and complemented strains

    • Checkerboard assays to identify synergy between HtpX inhibition and antibiotic action

  • Gene expression analysis:

    • Transcriptomic profiling of wild-type and htpX mutant strains during antibiotic exposure

    • Quantitative RT-PCR to monitor expression of resistance genes

    • Reporter gene fusions to monitor htpX expression in response to different antibiotics

  • Protein quality control assessment:

    • Monitoring accumulation of misfolded proteins in wild-type versus htpX mutant strains

    • Pulse-chase experiments to measure protein turnover during antibiotic stress

    • Visualization of protein aggregates using fluorescent reporters

  • Membrane integrity studies:

    • Membrane permeability assays using fluorescent dyes

    • Lipidomic analysis to assess membrane composition changes

    • Measurement of antibiotic uptake and accumulation

  • Efflux pump function analysis:

    • Efflux pump activity assays using fluorescent substrates

    • Assessment of efflux pump expression and localization

    • Determination of interactions between HtpX and efflux pump components

These approaches can reveal the specific mechanisms by which HtpX contributes to antibiotic resistance, potentially identifying new strategies for overcoming resistance in S. typhimurium infections.

How can researchers develop and validate specific inhibitors targeting HtpX protease?

Developing HtpX inhibitors as potential aminoglycoside adjuvants requires a systematic approach:

  • Inhibitor discovery strategies:

    • High-throughput screening of chemical libraries using activity-based assays

    • Structure-based design if structural information is available

    • Peptide-based inhibitors mimicking substrate recognition motifs

    • Repurposing known metalloprotease inhibitors with appropriate modifications

  • Validation of inhibitor specificity:

    • Testing against purified HtpX enzyme

    • Selectivity profiling against other bacterial proteases

    • Assessment of activity against human metalloproteases to avoid toxicity

    • Determination of inhibition mechanism and binding kinetics

  • Cellular activity evaluation:

    • Measurement of inhibitor uptake and accumulation in bacterial cells

    • Assessment of effects on bacterial growth and survival

    • Determination of antibiotic potentiation in combination treatments

    • Evaluation of resistance development potential

  • In vivo efficacy testing:

    • Pharmacokinetic and pharmacodynamic studies in animal models

    • Efficacy in infection models using wild-type S. typhimurium

    • Toxicity and safety evaluation

    • Combination therapy studies with aminoglycosides

Given that HtpX has been identified as a potential aminoglycoside adjuvant target in S. maltophilia , developing specific inhibitors could lead to novel therapeutic approaches for overcoming aminoglycoside resistance in S. typhimurium and related pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.