Recombinant Salmonella typhimurium Protein MgtC (mgtC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are sent with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your needs.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mgtC; STM14_4538; Protein MgtC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Salmonella typhimurium (strain 14028s / SGSC 2262)
Target Names
mgtC
Target Protein Sequence
MEERMLMFPYILNLLAAMLLGALIGAERQWRQRMAGLRTNALVATGAAVFILSSMTTSPD SPGRIAAQIVSGIGFLGAGVIMREGMNVRGLNTAATLWCSAGIGVLCGLGQFKNALAATI IILCANILLREAAQRINQLPISAEGEKRYILKVTCNKEDESAVRQWLLNIVKEAAICLQG LGSVPAQEQGYKEIRAELVGHADYRKTRELIISRIGDNDNITAIHWSIDSQ
Uniprot No.

Target Background

Function
MgtC is a virulence factor essential for Salmonella typhimurium growth in low Mg(2+) environments and intramacrophage survival. It may play a role in regulating membrane potential by activating Na(+)/K(+)-ATPase.
Database Links
Protein Families
MgtC/SapB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MgtC and what is its significance in Salmonella virulence?

MgtC is a virulence factor approximately 25 kDa in size that is encoded in the Salmonella pathogenicity island 3 (SPI-3). It is required for Salmonella growth in low-Mg²⁺ environments and for survival within macrophages . The protein has been repeatedly acquired by horizontal gene transfer throughout bacterial evolution and is present in other pathogenic bacteria including Mycobacterium tuberculosis and Brucella suis . MgtC represents one of the most important virulence factors encoded within SPI-3, as demonstrated by studies showing that MgtC deletion mutants exhibit significant attenuation in infection models .

How is MgtC expression regulated in Salmonella?

MgtC expression is regulated by multiple environmental signals and regulatory systems:

  • Low magnesium concentration (Mg²⁺ deprivation) strongly induces mgtC expression

  • Acidic pH environments trigger increased expression of the mgtC gene

  • The PhoP-PhoQ two-component system is a critical regulator that induces mgtC expression in response to low Mg²⁺ levels and acidic conditions

  • MgtC is co-transcribed with mgtB, which encodes a Mg²⁺ transporter, although MgtC is not required for MgtB function

  • Negative feedback regulation occurs through MgtR, a small polypeptide encoded by the mgtCB operon that promotes MgtC degradation by bacterial proteases

What experimental approaches are commonly used to study MgtC function?

Several experimental approaches are used to investigate MgtC function:

  • Gene deletion methods: Creation of mgtC and SPI-3 mutant strains through targeted gene deletion

  • Complementation assays: Restoration of wild-type phenotypes in mutant strains using mgtC-containing plasmids

  • Reporter gene assays: Utilization of reporter genes to monitor mgtC expression under different conditions (low Mg²⁺, acidic pH)

  • Cellular infection models: Testing bacterial survival within macrophage cell lines (J774) and epithelial cells (HEp-2)

  • Animal infection models: Using mouse models and zebrafish (Danio rerio) transgenic reporter lines to study host-pathogen interactions

  • Protein interaction studies: Investigating MgtC interactions with bacterial components like the F₁F₀ ATP synthase

What is the mechanistic relationship between MgtC and ATP synthesis?

MgtC has been shown to interact with and inhibit the F₁F₀ ATP synthase, thereby reducing ATP levels within Salmonella . This interaction appears to be crucial for virulence as it leads to downstream effects on cyclic diguanylate (c-di-GMP) levels. The reduction in ATP by MgtC prevents the rise in c-di-GMP, a second messenger that promotes biofilm formation . This mechanism represents a sophisticated virulence strategy where MgtC represses traits that would otherwise interfere with pathogenesis.

The interaction data can be summarized as follows:

MgtC FunctionATP ImpactDownstream EffectVirulence Outcome
Inhibition of F₁F₀ ATP synthaseReduced ATP levelsDecreased c-di-GMP productionEnhanced virulence
Absence of MgtCNormal/high ATP levelsIncreased c-di-GMP productionReduced virulence

How does MgtC contribute to cellulose regulation and why is this important for Salmonella virulence?

Recent research has revealed that MgtC represses cellulose biosynthesis in Salmonella, which is a previously unrecognized mechanism contributing to virulence . Experimental evidence indicates that:

  • MgtC prevents cellulose biosynthesis and/or its surface deployment

  • This occurs through reduced expression of the cellulose synthase gene bcsA

  • MgtC also affects levels of cyclic diguanylate, the allosteric activator of the BcsA protein

  • Cellulose production inside macrophages interferes with bacterial replication

  • Inactivation of bcsA restored wild-type virulence to a Salmonella mgtC mutant

This represents a critical example of how a virulence determinant can promote pathogenicity by repressing an antivirulence trait (cellulose). The data suggests a trade-off between acute virulence and transmission, where controlling antivirulence traits like cellulose production enhances long-term pathogen fitness .

What methodological challenges exist when studying MgtC function in different bacterial species?

Researchers face several methodological challenges when studying MgtC across different bacterial species:

  • Conservation vs. function variation: While MgtC is conserved in various pathogens (Salmonella, Mycobacterium, Brucella), its specific role in virulence can differ significantly. For example, in Mycobacterium marinum, MgtC affects phagocytosis but is dispensable for intracellular multiplication, unlike in Salmonella .

  • Appropriate model selection: Different bacterial species require different infection models. The zebrafish model works well for M. marinum studies while mouse models are better suited for S. Typhimurium. Cell-specific responses also vary - M. marinum MgtC affects neutrophil phagocytosis while S. Typhimurium studies focus on macrophage survival .

  • Temporal considerations: The timing of MgtC requirement differs between species and cell types. S. Typhi requires MgtC from the initial infection phase in epithelial cells, while other species may require it at different stages .

  • Technical detection challenges: Measuring MgtC protein levels inside host cells requires sensitive techniques. Experimental data shows the mgtU mutant of S. Typhimurium had three-fold lower MgtB amounts inside Slc11a1+/+ macrophages compared to wild-type strains .

How can researchers design experiments to evaluate the separate functions of MgtC in magnesium homeostasis versus intracellular survival?

Designing experiments to distinguish between MgtC's role in magnesium homeostasis and intracellular survival requires careful methodological considerations:

  • Complementation with domain-specific mutants: Create MgtC variants with mutations in specific domains and test their ability to complement an mgtC deletion strain for:

    • Growth in defined low-Mg²⁺ media

    • Survival within macrophages

    • Interaction with the F₁F₀ ATP synthase

  • Controlled environmental manipulations:

    • Test bacterial survival in macrophages cultured in media with varying Mg²⁺ concentrations

    • Use ionophores to manipulate intracellular Mg²⁺ levels

    • Compare wild-type and mgtC mutant growth under different pH conditions while controlling Mg²⁺ availability

  • Transcriptomic and proteomic analyses:

    • Compare gene/protein expression profiles of wild-type and mgtC mutants under:
      a) Low Mg²⁺ conditions outside host cells
      b) Within macrophages with normal Mg²⁺ supply
      c) Within macrophages under Mg²⁺ restriction

  • Protein interaction studies:

    • Identify and characterize MgtC interaction partners under different conditions

    • Determine if interactions with the F₁F₀ ATP synthase are Mg²⁺-dependent

    • Investigate whether MgtC functions as a Mg²⁺ sensor or directly binds Mg²⁺

What are the optimal conditions for inducing and detecting MgtC expression in laboratory settings?

Based on research findings, the following conditions optimize MgtC expression and detection:

  • Media composition:

    • Defined N-minimal medium with low Mg²⁺ concentration (10-20 μM)

    • pH adjusted to 5.5-6.0 to mimic the acidic phagosomal environment

    • Supplementation with 0.1% casamino acids and 38 mM glycerol

  • Growth conditions:

    • Early to mid-logarithmic phase cultures (OD₆₀₀ = 0.4-0.6)

    • Temperature of 37°C to mimic host physiological conditions

    • Microaerobic conditions may better simulate intracellular environments

  • Detection methods:

    • Reporter gene constructs (lacZ, gfp) fused to the mgtC promoter provide quantitative measurements of expression

    • Quantitative RT-PCR for mRNA detection

    • Western blotting with specific antibodies for protein quantification

    • Fluorescence microscopy for spatial localization within bacterial cells

  • Temporal considerations:

    • Maximum expression typically occurs after 4-6 hours of Mg²⁺ limitation

    • Expression patterns may differ in intracellular versus in vitro conditions

How can researchers design effective mgtC knockout and complementation experiments?

Designing effective mgtC knockout and complementation experiments requires careful consideration of several factors:

  • Knockout strategy optimization:

    • Use precise gene deletion techniques (λ Red recombination) rather than insertional inactivation to avoid polar effects on downstream genes

    • Create unmarked deletions when possible to minimize impact on surrounding genes

    • Target specific domains to study structure-function relationships

    • Confirm deletion by both PCR and sequencing

    • Verify the absence of MgtC protein by Western blot

  • Complementation considerations:

    • Use low-copy plasmids with native promoters to avoid artifacts from overexpression

    • Include appropriate controls:

      • Empty vector control

      • Wild-type complementation

      • Point mutant complementation

    • Test complementation under multiple conditions (low Mg²⁺, within macrophages)

    • Quantify MgtC expression levels in complemented strains to ensure they match wild-type levels

  • Validation experiments:

    • Growth curves in low Mg²⁺ media

    • Intracellular survival assays in multiple cell types

    • Animal infection models

    • ATP level measurements

    • Cellulose production quantification

  • Potential pitfalls to avoid:

    • Polar effects on co-transcribed genes (e.g., mgtB)

    • Artifacts from non-physiological expression levels

    • Strain-specific differences in genetic background

    • Inadequate controls for plasmid maintenance in vivo

How should researchers interpret seemingly contradictory data regarding MgtC function across different bacterial species?

When confronted with contradictory data on MgtC function across bacterial species, researchers should consider:

  • Evolutionary context:

    • Despite horizontal gene transfer, MgtC homologs may have evolved different functions

    • Sequence similarity does not guarantee functional equivalence

    • Genomic context (neighboring genes) may influence function

  • Methodological differences:

    • Cell types used (epithelial cells vs. macrophages vs. neutrophils)

    • Animal models (mice vs. zebrafish)

    • Growth conditions and media composition

    • Sensitivity of detection methods

  • Analytical framework:

    • M. marinum MgtC affects phagocytosis but not intracellular replication

    • S. Typhimurium MgtC primarily impacts intramacrophage survival

    • S. Typhi MgtC affects early survival in epithelial cells, unlike other serovars

    • Different functions may reflect adaptation to distinct host niches

  • Experimental design for reconciliation:

    • Cross-complementation experiments between species

    • Domain swapping between MgtC homologs

    • Controlled side-by-side comparisons using identical methods

    • Structural studies to identify conserved and divergent regions

What statistical approaches are most appropriate for analyzing MgtC mutant phenotypes in infection models?

When analyzing MgtC mutant phenotypes in infection models, appropriate statistical approaches include:

  • For survival/growth assays:

    • Two-way ANOVA with repeated measures for time-course experiments

    • Post-hoc tests (Tukey or Bonferroni) for multiple comparisons

    • Log-transformation of bacterial counts to normalize data

    • Sample size calculations based on preliminary data to ensure adequate power (typically n≥3 biological replicates)

  • For animal infection models:

    • Kaplan-Meier survival analysis with log-rank test

    • Area under the curve (AUC) analysis for bacterial burden over time

    • Mixed-effects models for repeated measures with animal-specific random effects

    • Competitive index calculations for co-infection experiments

  • For gene expression data:

    • Normalization to multiple reference genes

    • ΔΔCT method for qRT-PCR

    • Multiple test correction for transcriptomic studies

    • Paired t-tests for before-after comparisons within the same experiment

  • For meta-analysis across studies:

    • As described in search result , meta-analytic methods can assess relationships between simulation factors and outcomes:

      • The mean and variance of outcomes must be available

      • The Q test for model misspecification relies on weighted error sum of squares

      • Rejection of the correctly specified hypothesis implies larger than expected weighted error variance

  • Addressing common statistical challenges:

    • Small sample sizes in animal studies

    • Variation in baseline susceptibility among host cells/animals

    • Non-normal distribution of bacterial counts

    • Temporal correlation in longitudinal studies

What are the emerging questions regarding the role of MgtC in bacterial stress adaptation beyond magnesium limitation?

Recent findings suggest MgtC functions extend beyond magnesium homeostasis to broader stress adaptation:

  • pH adaptation: MgtC expression is induced by acidic pH independent of Mg²⁺ levels, suggesting a role in acid stress response .

  • ATP homeostasis: MgtC's interaction with F₁F₀ ATP synthase indicates involvement in energy metabolism regulation under stress conditions .

  • Biofilm regulation: MgtC represses cellulose production, a major component of Salmonella biofilms, suggesting a role in lifestyle switching between acute infection and persistence states .

  • Host defense evasion: Evidence from M. marinum studies indicates MgtC may influence phagocytosis by neutrophils, suggesting broader functions in host-pathogen interactions .

  • Stress response integration: MgtC may serve as an integration point for multiple stress signals (nutrient limitation, pH, antimicrobial peptides) to coordinate appropriate bacterial responses.

Key research questions include:

  • Does MgtC respond to additional environmental stressors beyond Mg²⁺ and pH?

  • How does MgtC integrate with other stress response systems?

  • Does MgtC function vary in different host niches with distinct stress profiles?

  • Can MgtC function be targeted to sensitize bacteria to host defense mechanisms?

How might understanding MgtC function contribute to novel antimicrobial strategies?

Understanding MgtC function could inform novel antimicrobial strategies through several approaches:

  • Direct inhibition:

    • Small molecule inhibitors targeting MgtC could attenuate virulence without killing bacteria, potentially reducing selective pressure for resistance

    • Peptide mimetics based on MgtR could enhance natural MgtC degradation

    • Structure-based drug design targeting the MgtC-ATP synthase interaction

  • Indirect targeting:

    • Manipulation of host cell Mg²⁺ levels in infected tissues

    • Compounds that enhance cellulose production to interfere with intracellular replication

    • Strategies to increase ATP synthase activity, counteracting MgtC's inhibitory effect

  • Combination approaches:

    • MgtC inhibitors combined with conventional antibiotics for synergistic effects

    • MgtC inhibitors to sensitize bacteria to host defense mechanisms

    • Targeting multiple virulence factors simultaneously (MgtC + others)

  • Vaccine development:

    • Attenuated strains with modified MgtC as vaccine candidates

    • MgtC-derived peptides as vaccine antigens

    • Understanding MgtC-regulated pathways to identify additional vaccine targets

  • Host-directed therapies:

    • Modulation of host cell processes targeted by MgtC

    • Enhancement of antimicrobial responses normally suppressed by MgtC action

    • Manipulation of macrophage phagosomal conditions to bypass MgtC-mediated adaptation

What are common troubleshooting strategies for recombinant MgtC expression and purification?

Researchers working with recombinant MgtC often encounter technical challenges that can be addressed through specific troubleshooting approaches:

  • Expression optimization:

    • MgtC is a membrane protein, making expression and solubility challenging

    • Test multiple expression systems (E. coli, yeast, cell-free)

    • Optimize codon usage for the expression host

    • Try fusion tags that enhance solubility (MBP, SUMO, TrxA)

    • Evaluate different promoter strengths and induction conditions

    • Consider low-temperature induction (16-20°C)

  • Solubilization strategies:

    • Test various detergents (DDM, LDAO, C12E8)

    • Use mild solubilization conditions to maintain structure

    • Consider amphipols or nanodiscs for membrane protein stabilization

    • Attempt partial deletion of transmembrane domains if structural studies focus on cytoplasmic domains

  • Purification optimization:

    • Implement multi-step purification (affinity, ion exchange, size exclusion)

    • Maintain detergent above critical micelle concentration throughout purification

    • Include stabilizing agents (glycerol, specific lipids)

    • Optimize buffer conditions (pH, salt concentration)

    • Consider on-column refolding for inclusion body-derived protein

  • Quality control:

    • Circular dichroism to verify secondary structure

    • Size exclusion chromatography to assess oligomeric state

    • Thermal stability assays to optimize buffer conditions

    • Functional assays to confirm biological activity

How can researchers effectively design experiments to study MgtC-protein interactions?

Investigating MgtC-protein interactions requires careful experimental design:

  • Candidate approach methods:

    • Co-immunoprecipitation with specific antibodies

    • Bacterial two-hybrid systems

    • Split-GFP complementation assays

    • FRET/BRET approaches for live-cell interaction studies

    • Surface plasmon resonance for in vitro interaction kinetics

  • Unbiased screening methods:

    • Affinity purification coupled with mass spectrometry

    • Protein microarrays

    • Proximity labeling approaches (BioID, APEX)

    • Yeast two-hybrid screens using membrane protein-specific systems

    • Chemical crosslinking followed by mass spectrometry

  • Validation strategies:

    • Reciprocal co-immunoprecipitation

    • Domain mapping to identify interaction interfaces

    • Site-directed mutagenesis of putative interaction sites

    • Competition assays with peptides derived from interaction domains

    • Functional assays to demonstrate biological relevance

  • Control considerations:

    • Non-interacting membrane protein controls

    • Mutant variants with disrupted interaction potential

    • Competitive inhibition with excess unlabeled protein

    • Detergent controls to rule out non-specific hydrophobic interactions

    • Expression level controls to avoid overexpression artifacts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.