Recombinant Salmonella typhimurium Protein prgH (prgH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
prgH; STM2874; Protein PrgH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
prgH
Target Protein Sequence
METSKEKTITSPGPYIVRLLNSSLNGCEFPLLTGRTLFVVGQSDALTASGQLPDIPADSF FIPLDHGGVNFEIQVDTDATEIILHELKEGNSESRSVQLNTPIQVGELLILIRPESEPWV PEQPEKLETSAKKNEPRFKNGIVAALAGFFILGIGTVGTLWILNSPQRQAAELDSLLGQE KERFQVLPGRDKMLYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYY PQLAYYRIHFDEPRKPVFWLSRQRNTMSKKELEVLSQKLRALMPYADSVNITLMDDVTAA GQAEAGLKQQALPYSRRNHKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIE LKDDWLKGRSFQYGAEGYIKMSPGHWYFPSPL
Uniprot No.

Target Background

Function
Essential for invasion of epithelial cells.
Database Links

KEGG: stm:STM2874

STRING: 99287.STM2874

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is PrgH and where is it located in Salmonella typhimurium?

PrgH is a 55 kDa protein encoded by the prgHIJK operon within Salmonella pathogenicity island 1 (SPI1). It functions as a crucial structural component of the Type III Secretion System (T3SS), also referred to as the injectisome . PrgH contains a hydrophobic domain that directs its insertion and retention within the inner bacterial membrane . Within the needle complex structure, PrgH is specifically located at the periphery of the inner ring 1 (IR1), as demonstrated through poly-histidine insertion labeling experiments and subsequent cryo-electron microscopy analysis .

How does PrgH relate to other proteins in the prgHIJK operon?

The prgHIJK operon encodes four essential proteins (PrgH, PrgI, PrgJ, and PrgK) that function as components of the Salmonella typhimurium SPI1 T3SS . While PrgH (55 kDa) and PrgK (28 kDa) primarily form the inner membrane structural components of the secretion apparatus, PrgI (6 kDa) and PrgJ (11 kDa) have different roles . PrgI forms the external needle filament protruding from the bacterial surface, while PrgJ interacts with the needle complex as demonstrated by co-fractionation studies . Deletion studies of individual prg genes have conclusively shown that all four proteins are required for functional type III secretion and invasion of epithelial cells .

How does PrgH contribute to the formation of the needle complex structure?

PrgH plays a fundamental role in needle complex assembly through several mechanisms:

  • Multimerization capacity: PrgH can independently multimerize into a distinct tetrameric-shaped structure that likely serves as an early intermediate in needle complex assembly .

  • Structural foundation: The PrgH tetrameric structure appears to provide the structural foundation required for PrgK oligomerization, as PrgK does not form definitive structures when expressed alone .

  • Ring formation: When PrgH and PrgK are co-expressed, they oligomerize into ring-shaped structures identical in appearance and size to the base of the needle complex, with dimensions of approximately 22 nm width, 9 nm height, and an inner diameter of 12 nm .

  • Assembly sequence: Evidence suggests PrgH multimerization may occur first, followed by PrgK assembly, which is dependent on the presence of PrgH . This hierarchical assembly process is critical for proper formation of the secretion apparatus.

What experimental approaches can be used to study PrgH-protein interactions within the T3SS complex?

Several experimental approaches have proven effective for investigating PrgH interactions:

  • In vivo cross-linking with formaldehyde: This approach stabilizes protein interactions prior to purification. Optimization typically involves testing formaldehyde concentrations ranging from 0.5-3% to determine ideal cross-linking conditions .

  • Tandem affinity purification: A modified method involving:

    • Addition of a histidine-biotin-histidine (HBH) tag to bait proteins via recombinant DNA techniques

    • Cross-linking with formaldehyde in vivo

    • Two-step purification under fully denaturing conditions

    • Identification of cross-linked protein partners using LC-MS/MS

  • Site-specific labeling: Researchers have successfully introduced poly-histidine insertion linkers (e.g., after amino acid 267 in PrgH) to create functional tagged proteins that can be labeled with Ni-NTA-nanogold and examined by cryo-electron microscopy .

  • Surface accessibility analysis: Chemical modification of surface-exposed lysine residues (using reagents like Sulfo-NHS-Acetate) followed by mass spectrometry analysis to determine structural relationships between complex components .

How do recombinant forms of PrgH differ structurally or functionally from native protein?

Recombinant forms of PrgH typically include affinity tags that may influence structure or function:

What is the specific function of PrgH in Salmonella typhimurium virulence?

PrgH serves multiple critical functions in Salmonella virulence:

  • T3SS structural integrity: As a major structural component of the needle complex base, PrgH is essential for establishing a functional secretion apparatus that delivers bacterial effector proteins into host cells .

  • Epithelial cell invasion: Deletion studies conclusively demonstrate that PrgH is required for invasion of epithelial cells, a key step in Salmonella pathogenesis. Strains lacking PrgH show a 50-100 fold reduction in invasion capacity compared to wild-type strains .

  • Secretion of virulence factors: PrgH is necessary for the type III secretion of effector proteins into the culture supernatant. Deletion of prgH abolishes secretion of these virulence factors completely .

  • Signal transduction: Although indirect, PrgH contributes to the proper assembly of the needle complex structure, which is involved in transducing activating signals to the secretion machine .

How do mutations in PrgH affect T3SS function and bacterial virulence?

Mutation studies reveal significant functional consequences:

  • Deletion mutants: Complete deletion of prgH (ΔprgH) results in:

    • Abolishment of type III secretion

    • 50-100 fold reduction in epithelial cell invasion

    • Inability to form needle complexes

  • C-terminal truncations: Truncating the C-terminus of PrgH weakens the interaction between PrgH and InvG (outer ring component), affecting needle complex stability .

  • Complementation analysis: The non-polar nature of prgH mutations has been demonstrated through successful complementation with plasmids expressing the corresponding wild-type gene, confirming the direct role of PrgH in virulence rather than polar effects on downstream genes .

How does PrgH interact with host immune systems during infection?

While the search results don't directly address PrgH-specific immune interactions, related T3SS components provide insight:

  • Needle protein detection: T3SS needle proteins (like PrgI) can interact with host Toll-like receptors (TLR2 or TLR4) and induce signaling through NF-κB and/or AP-1 pathways .

  • Cytokine induction: These interactions lead to MyD88-dependent activation resulting in increased expression of pro-inflammatory cytokines, including TNF-alpha, IL-6, and IL-8 .

  • Innate immune recognition: The needle complex structure that PrgH helps form is likely recognized as a pathogen-associated molecular pattern (PAMP) by host pattern recognition receptors, triggering innate immune responses.

What are the optimal expression systems and conditions for producing recombinant PrgH?

Based on successful recombinant protein production methods described in the search results:

  • Expression host: E. coli BL21(DE3) is commonly used as an expression host for recombinant Salmonella proteins .

  • Vector selection: Low-copy vectors like pWSK29 under the control of the native prgH promoter have been successfully used for expression . For higher expression, vectors with inducible promoters like pET systems may be appropriate.

  • Growth conditions:

    • Growth in LB broth/agar supplemented with appropriate antibiotics (e.g., 100 μg/mL ampicillin)

    • Temperature: 37°C for optimal growth

    • Induction parameters: Will depend on the promoter system used

  • Tag design considerations:

    • C-terminal His-tags (6x or 18x) for purification purposes

    • N-terminal His-tags as alternatives

    • Internal His-tags (e.g., after M267) have been successfully implemented while maintaining protein function

What purification methods yield the highest purity and functional recombinant PrgH?

Effective purification strategies include:

  • Affinity chromatography: Ni-NTA agarose purification for His-tagged PrgH variants, which can achieve >90% purity when optimized .

  • Tandem purification approach:

    • For complex interaction studies, a histidine-biotin-histidine (HBH) tagging strategy allows two-step purification

    • First purification using Ni-NTA under denaturing conditions

    • Secondary purification using streptavidin affinity

  • Denaturing vs. native conditions:

    • Denaturing conditions (containing urea) are often used for initial purification: 20 mM NaH₂PO₄, 500 mM NaCl, 6 M Urea, 250 mM Imidazole, pH 7.4

    • Refolding protocols may be necessary depending on downstream applications

  • Validation methods:

    • SDS-PAGE analysis to confirm >90% purity

    • Western blot using anti-His antibodies to confirm identity

What analytical techniques are most effective for characterizing PrgH structure and interactions?

Several complementary analytical approaches have proven valuable:

  • Cryo-electron microscopy and single particle analysis: Particularly effective for visualizing PrgH within larger complexes and determining its location within the needle complex structure .

  • Chemical cross-linking:

    • In vivo formaldehyde cross-linking (0.5-3%) to stabilize protein interactions

    • Optimization of cross-linking conditions is critical for success

  • Mass spectrometry:

    • For identification of cross-linked partners

    • Analysis of surface-exposed residues through chemical modification patterns

  • Functional validation:

    • Secretion assays measuring effector protein release (e.g., SipB, SptP)

    • Invasion assays using epithelial cell lines like HeLa cells to test for functional complementation

How can recombinant PrgH be used to develop novel antimicrobial strategies?

The essential role of PrgH in virulence presents several potential antimicrobial strategies:

  • T3SS inhibitor development: Recombinant PrgH can serve as a target for high-throughput screening of small molecules that disrupt needle complex assembly or stability.

  • Structure-based drug design: The detailed structural information available for PrgH and its interactions with PrgK provides a foundation for rational design of inhibitors targeting these protein-protein interfaces.

  • Vaccination approaches: While PrgH itself hasn't been directly tested as a vaccine candidate in the search results, the successful development of recombinant InvH (another T3SS component) as a protective subunit vaccine suggests similar approaches might be viable for PrgH . The recombinant InvH protein demonstrated:

    • Significant IgG response in immunized mice

    • 100% protection against homologous challenge

    • 90% protection against heterologous serovars challenge

What are the most challenging aspects of working with recombinant PrgH and how can they be addressed?

Based on the technical approaches described in the search results:

  • Maintaining native conformation:

    • Challenge: Ensuring recombinant PrgH folds correctly when expressed in heterologous systems

    • Solution: Co-expression with interacting partners like PrgK may improve folding and stability

  • Tag interference with function:

    • Challenge: Affinity tags may disrupt protein-protein interactions or complex assembly

    • Solution: Careful selection of tag location based on structural data; internal tagging at permissive sites (e.g., after residue 267); functional validation of tagged constructs

  • Protein-protein interaction analysis:

    • Challenge: Transient or weak interactions may be difficult to capture

    • Solution: Optimized cross-linking protocols; tandem affinity purification under denaturing conditions to reduce non-specific interactions

  • Complex assembly in vitro:

    • Challenge: Reconstituting functional needle complex structures from purified components

    • Solution: Sequential addition of components reflecting the natural assembly pathway; appropriate membrane mimetics for transmembrane domains

How does the function of PrgH compare across different bacterial species with homologous T3SS components?

While the search results focus primarily on Salmonella typhimurium PrgH, comparative analysis reveals:

  • Conserved vs. unique features:

    • PrgH is found in the Salmonella SPI1 and Shigella mxi/spa T3SS but appears less conserved across all T3SS systems compared to some other components

    • In contrast, PrgK and its homologs are among the most highly conserved T3SS proteins across species

  • Functional analogs in other systems:

    • Shigella flexneri contains MxiG, which may serve as the functional analog to PrgH

    • PrgJ shares homology with Shigella MxiI

  • Evolutionary implications:

    • The conservation pattern suggests PrgH may have evolved to meet specific needs of the Salmonella and Shigella T3SS, while the core structural proteins like PrgK are more universally required across different bacterial T3SS machineries

What are the newest methodological advances in studying PrgH and T3SS structure?

Recent methodological innovations include:

  • Advanced cryo-EM techniques: Higher resolution structural analysis of the T3SS needle complex has significantly improved understanding of component organization and interactions .

  • Integrated experimental approaches: Combining cryo-electron microscopy with bacterial genetics, site-specific labeling, and mass spectrometry has provided more comprehensive insights into T3SS assembly and function .

  • Surface accessibility mapping: Chemical modification of exposed residues coupled with mass spectrometry analysis has enabled more precise determination of protein topology within complex structures .

What are the current gaps in understanding PrgH function and structure?

Despite significant progress, several important questions remain:

  • Assembly dynamics: The precise temporal sequence and kinetics of needle complex assembly, including PrgH incorporation, remains incompletely understood.

  • Regulatory mechanisms: How environmental signals regulate PrgH expression and incorporation into the needle complex structure requires further investigation.

  • Structural transitions: Changes in PrgH conformation or interactions during the activation of the secretion system have not been fully characterized.

  • Host-pathogen interface: The potential for direct interaction between PrgH and host cellular components, if any, has not been thoroughly explored.

How can systems biology approaches enhance our understanding of PrgH in the context of Salmonella pathogenesis?

Systems approaches offer promising avenues for investigation:

  • Protein-protein interaction networks: Comprehensive mapping of all PrgH interactions using methods like the tandem affinity purification described in the search results could reveal unexpected functional connections.

  • Integrative modeling: Combining structural data from multiple techniques (X-ray crystallography, cryo-EM, cross-linking MS) to build more complete models of the T3SS and its dynamic assembly.

  • Multi-omics integration: Correlating proteomic data on PrgH interactions with transcriptomic and metabolomic changes during infection to understand the broader context of T3SS function.

  • Host response integration: Mapping how PrgH-dependent T3SS assembly and function correlates with host immune responses and cellular changes to identify key intervention points.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.