Recombinant Salmonella typhimurium Protein sirB2 (sirB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific requirements for the format, please include them in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution. Store aliquots at -20°C or -80°C. The default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C or -80°C. Lyophilized form typically has a shelf life of 12 months at -20°C or -80°C.
Storage Condition
Upon receipt, store at -20°C or -80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
sirB2; orf2; STM1774; Protein SirB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
sirB2
Target Protein Sequence
MTIAMLLTLHLICVALSVSLFVARYWWRYCGHALAAARWTRIVPPVIDTLLLLSGIGLIV KTHILPFTESGSWLTEKLFGVIIYIVLGFIALDYRQARSQQARFIAFPLALVVLYIIIKL ATTKIPLLG
Uniprot No.

Target Background

Function
Required for maximal expression of sirC, not required to invade host cells.
Database Links

KEGG: stm:STM1774

STRING: 99287.STM1774

Protein Families
SirB2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does recombinant sirB2 protein expression compare to its native expression patterns?

Recombinant sirB2 protein expression typically occurs in heterologous systems like E. coli, where the protein can be produced with tags (such as His-tag) to facilitate purification . This differs from native expression, which is likely regulated by Salmonella's complex virulence control systems.

To study physiologically relevant expression patterns, researchers should:

  • Compare expression under different growth conditions mimicking host environments

  • Analyze expression during different infection stages

  • Consider using SPI2-derived promoters that activate specifically within host cells

Studies with similar Salmonella proteins demonstrate that expression patterns can differ significantly between in vitro and in vivo conditions, with some virulence factors specifically expressed only after uptake by host cells like dendritic cells .

What is the most efficient expression system for producing recombinant sirB2 protein?

E. coli is the most commonly used expression system for recombinant sirB2 protein production . The methodological approach should include:

  • Vector selection: Low-copy vectors are preferable for potentially toxic proteins. For sirB2, His-tagged constructs have been successfully produced.

  • Expression conditions: Optimize temperature, IPTG concentration, and induction time.

  • Protein purification: Use Ni-NTA affinity chromatography for His-tagged sirB2 protein.

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, simple culture conditions, established protocolsMay lack proper folding for complex proteinsStructural studies, antibody production
Attenuated SalmonellaNative-like folding, suitable for vaccine developmentLower yields, more complex handlingImmunological studies, vaccine development
Mammalian cellsPost-translational modifications, proper foldingExpensive, lower yieldsFunctional assays, protein-protein interactions

For vaccine applications, expressing sirB2 within attenuated Salmonella strains using intracellular-activated promoters may enhance immunogenicity compared to constitutive expression systems .

How can I optimize the stability and solubility of recombinant sirB2 protein?

Optimizing stability and solubility of recombinant sirB2 requires careful consideration of several parameters:

  • Storage conditions: Store purified protein at -20°C/-80°C, with 5-50% glycerol addition recommended to prevent freeze-thaw damage. Aliquot to avoid repeated freeze-thaw cycles .

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 50% final concentration for long-term storage

    • For working stocks, store aliquots at 4°C for up to one week

  • Buffer optimization:

    • Standard storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Consider screening various buffers with additives to improve solubility

    • Test protein stability in experimental buffers before conducting assays

When working with membrane-associated proteins like sirB2, consider using mild detergents to maintain native conformation and improve solubility while preserving functional characteristics.

How can I assess the immunogenicity of recombinant sirB2 when used as a potential vaccine antigen?

Assessing immunogenicity of recombinant sirB2 for vaccine applications requires a multi-faceted approach:

  • In vitro assays:

    • Western blot analysis using anti-sirB2 antibodies to confirm expression

    • Analysis of antigen presentation by dendritic cells using flow cytometry

    • T-cell proliferation assays to measure cellular immune responses

    • Cytokine profiling to characterize immune response patterns

  • In vivo evaluations:

    • Antibody titer measurements in immunized animals

    • Challenge studies to assess protection against Salmonella infection

    • Analysis of bacterial burden in organs following challenge

    • Histopathological assessment to evaluate tissue damage

Based on studies with similar Salmonella antigens, expression using intracellular-activated promoters may enhance immunogenicity compared to constitutive expression. For example, research has shown that model antigens expressed under control of intracellular-activated SPI2 promoters resulted in stronger immune responses than constitutively expressed antigens . This approach led to approximately two orders of magnitude lower organ burden following challenge in immunized animals compared to control groups.

What role might sirB2 play in SIRT2-mediated immune responses during Salmonella infection?

While direct interaction between sirB2 and SIRT2 is not established in the provided literature, understanding SIRT2-mediated immune responses is critical for Salmonella infection studies and potential therapeutic targeting:

  • Salmonella upregulates SIRT2 (sirtuin 2), an NAD+-dependent deacetylase, in dendritic cells (DCs)

  • SIRT2 upregulation leads to:

    • Translocation of NFκB p65 to the nucleus

    • Upregulation of NOS2 transcription

    • Increased nitric oxide (NO) production

    • Dual effects: antibacterial activity and suppression of T cell proliferation

  • SIRT2 involvement creates a complex dynamic:

    • In vitro: SIRT2 inhibition increases intracellular bacterial survival but enhances antigen presentation

    • In vivo: SIRT2 inhibition reduces bacterial organ burden and tissue damage

This suggests investigating whether sirB2 interacts with SIRT2-dependent pathways could reveal important host-pathogen interactions that might be exploited for therapeutic development.

How can I develop a live attenuated Salmonella vaccine strain expressing recombinant sirB2?

Developing a live attenuated Salmonella vaccine strain expressing recombinant sirB2 involves several crucial methodological steps:

  • Selection of appropriate attenuated strain:

    • Common attenuated strains include those with mutations in aroA, asd, or SPI2 genes (e.g., sseC)

    • SPI2-deficient strains may be more effective for intracellular antigen expression than traditional aroA strains

  • Promoter selection for optimal expression:

    • Constitutive promoters: Provide continuous antigen expression

    • Intracellular-activated promoters (e.g., SPI2-derived promoters): Restrict expression to relevant host-microbe interaction phases

    • Studies have shown intracellular-activated promoters like Pro sseA elicit stronger immune responses than constitutive promoters

  • Vector construction:

    • Clone the sirB2 gene into an appropriate vector (e.g., asd+ vector pYA3342)

    • Confirm insertion by PCR amplification, restriction digestion, and sequencing

    • Consider creating fusion constructs with immunogenic epitopes to enhance response

  • Verification steps:

    • Confirm expression by RT-PCR and Western blot

    • Assess stability of the recombinant strain after multiple passages (minimum 5 days in vitro)

    • Verify immunoreactivity of expressed protein using commercial antibodies

Research has demonstrated that using intracellular-activated promoters for antigen expression in Salmonella carrier strains generates more efficient humoral and cellular immune responses than constitutive expression .

What are the optimal statistical methods for analyzing high-throughput screens involving sirB2?

When conducting high-throughput screens with sirB2, applying appropriate statistical methods is crucial given the inherent variability in RNAi screens compared to small-molecule screens:

  • Key differences to consider:

    • RNAi screens show approximately twice the coefficient of variation of small-molecule screens (26.5% vs. 13.4%)

    • Z'-factors from RNAi screens tend to be lower (frequently between 0.0 and 0.5)

  • Recommended statistical approaches:

MethodApplicationAdvantagesLimitations
Strictly Standardized Mean Difference (SSMD)Ranking hits in primary screensMore robust to variability, less affected by outliersRequires careful selection of controls
Redundant siRNA Activity (RSA)Secondary validationAccounts for multiple siRNAs per gene, reduces false positivesComputationally intensive
Bayesian analysisHit identificationProvides hit p-values, uses both plate-wide and experiment-wide informationMore complex to implement
  • Experimental design considerations:

    • Careful plate layout is critical as RNAi screens are particularly susceptible to edge effects

    • Include multiple controls distributed strategically across plates

    • Consider positional effects in data normalization

For computational analysis, employ specialized software packages designed for high-throughput screens, applying plate normalization followed by robust statistical methods appropriate for the specific screen design.

How can I resolve issues with low expression levels of recombinant sirB2 protein?

Low expression levels of recombinant sirB2 can be addressed through several methodological interventions:

  • Optimize codon usage:

    • Analyze the sirB2 sequence for rare codons in the expression host

    • Synthesize a codon-optimized gene for the expression system

    • This is particularly important when expressing bacterial proteins in eukaryotic systems

  • Adjust expression conditions:

    • Test multiple induction temperatures (15°C, 25°C, 37°C)

    • Vary IPTG concentrations (0.1-1.0 mM)

    • Consider auto-induction media which can yield higher protein levels for some constructs

  • Expression vectors and hosts:

    • Test different fusion tags (His, GST, MBP) as MBP can enhance solubility

    • Evaluate specialized E. coli strains (BL21, Rosetta, Arctic Express)

    • For membrane-associated proteins like sirB2, consider C41/C43 strains

  • Purification strategy optimization:

    • Use denaturing conditions if necessary, followed by refolding

    • Implement stepwise purification to increase purity and yield

    • Consider on-column refolding techniques for insoluble proteins

What are the most effective ways to evaluate sirB2 involvement in Salmonella pathogenesis in vivo?

Evaluating sirB2's role in Salmonella pathogenesis requires comprehensive in vivo approaches:

  • Genetic manipulation strategies:

    • Generate sirB2 knockout strains using CRISPR-Cas9 or lambda Red recombination

    • Create complemented strains to confirm phenotype restoration

    • Develop point mutations in key functional domains to assess specific activities

  • Animal infection models:

    • Mouse typhoid model: Assesses systemic spread and organ colonization

    • Streptomycin-pretreated mouse model: Better replicates intestinal inflammation

    • Calves or other natural hosts: Provides more physiologically relevant context

  • Evaluation parameters:

    • Bacterial burden in tissues (spleen, liver, intestine)

    • Histopathological analysis of tissue damage

    • Immune response profiling (cytokines, immune cell recruitment)

    • Survival analysis following lethal challenge

  • Advanced in vivo techniques:

    • Intravital microscopy to monitor Salmonella-host cell interactions

    • Multi-parameter flow cytometry to assess immune cell populations

    • Transcriptomics and proteomics of infected tissues

    • SIRT2 inhibition or knockout models to assess potential interactions

Research with related Salmonella virulence factors shows that SIRT2 knockout mice demonstrate reduced bacterial organ burden compared to wild-type mice, suggesting potential therapeutic targets in this pathway . Similar approaches could be applied to evaluate sirB2's specific contributions to pathogenesis.

How might sirB2 be utilized in developing novel therapeutic approaches against Salmonella infection?

Exploration of sirB2 as a therapeutic target encompasses several promising research avenues:

  • Vaccine development strategies:

    • Incorporation of sirB2 in subunit vaccine formulations

    • Expression in attenuated Salmonella strains using intracellular-activated promoters

    • Combination with other immunogenic antigens for enhanced protection

    • Development of DNA vaccines expressing sirB2

  • Therapeutic targeting approaches:

    • Design of small molecule inhibitors targeting sirB2 function

    • Antibody-based therapies neutralizing sirB2 activity

    • Exploration of potential interactions with SIRT2-dependent pathways

  • Potential applications in adjuvant development:

    • Utilizing sirB2 to enhance immune responses to co-delivered antigens

    • Development of nanoparticle delivery systems incorporating sirB2

The dual nature of SIRT2's role in Salmonella pathogenesis, with its importance in both bacterial clearance and T-cell response suppression , suggests exploring similar pathway interactions for sirB2 could yield valuable insights for therapeutic development.

What are the key considerations for designing a high-throughput screen to identify inhibitors of sirB2?

Designing an effective high-throughput screen for sirB2 inhibitors requires addressing several critical factors:

  • Assay development considerations:

    • Determine measurable functional activity of sirB2

    • Develop a robust, reproducible assay with good signal-to-background ratio

    • Establish clear positive and negative controls

    • Optimize assay for 384 or 1536-well format

  • Statistical analysis framework:

    • Implement appropriate normalization methods to account for plate-to-plate variation

    • Consider robust statistical parameters like Z'-factor, SSMD, or other metrics appropriate for the assay type

    • Account for edge effects in plate-based assays

  • Screening strategy:

    • Primary screen: Initial broad compound library testing

    • Secondary validation: Dose-response curves, orthogonal assays

    • Counter-screening: Eliminate compounds with non-specific effects

    • Mechanism of action studies: Determine how hits interact with sirB2

  • Compound selection:

    • Diversity-oriented libraries for novel chemical space exploration

    • Focused libraries based on structural information about sirB2

    • Repurposing libraries of approved drugs for accelerated development

This methodological approach balances throughput with specificity, ensuring efficient identification of potential sirB2 inhibitors while minimizing false positives that plague many high-throughput screening campaigns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.