Recombinant Salmonella typhimurium Putative 2-aminoethylphosphonate transport system permease protein phnV (phnV)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

PhnV is a permease component of the ATP-binding cassette (ABC) transporter system in Salmonella typhimurium. It works alongside PhnS, PhnT, and PhnU to import 2-AEP, a phosphonate used as a phosphorus source when inorganic phosphate is scarce . The recombinant form is produced in Escherichia coli for research applications, enabling studies on bacterial nutrient uptake and phosphonate metabolism .

Functional Role in 2-AEP Metabolism

PhnV is essential for the PhnSTUV transporter complex, which imports 2-AEP into the cell. Key functional insights include:

  • Substrate Specificity: Part of a system dedicated to 2-AEP uptake, distinct from other phosphonate transporters like AepXVW .

  • Metabolic Pathway: 2-AEP is catabolized via the C-P lyase pathway to release inorganic phosphate, supporting bacterial growth under phosphorus limitation .

  • pH Sensitivity: Related enzymes in the pathway (e.g., PhnW transaminase) exhibit optimal activity at pH 8.5 .

Research Findings

Recent studies highlight its role in bacterial physiology and potential applications:

Table 1: Key Research Studies

Study FocusMethodologyFindingsSource
Transport MechanismGene knockout and complementation assaysΔphnV mutants show impaired 2-AEP uptake as a phosphorus source .
Enzymatic CoordinationKinetic profiling of PhnW transaminasePhnV works upstream of PhnW, which converts 2-AEP to phosphonoacetaldehyde .
Recombinant ProductionE. coli-based expressionHigh-purity PhnV produced for antibody development and structural studies .

Applications and Implications

  • Research Tool: Used to study ABC transporter mechanisms and phosphonate metabolism .

  • Biotechnological Potential: Insights into PhnV could inform strategies to disrupt bacterial phosphorus acquisition, aiding antimicrobial development .

  • Diagnostic Use: Recombinant PhnV serves as an antigen in ELISA kits for pathogen-specific antibody detection .

Future Directions

  • Structural Resolution: Cryo-EM studies to elucidate transmembrane domain architecture.

  • Pathogenicity Links: Investigate PhnV’s role in Salmonella survival in host environments.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag type if possible.
Synonyms
phnV; STM0426; Putative 2-aminoethylphosphonate transport system permease protein PhnV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
phnV
Target Protein Sequence
MLIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGILPSGFTLNHFVNALHGA AWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGI LVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLARISADIENVASSLGASPWYRL RHVTLPLLMPWMMSALALSLSLSMGELGATMMIYPPGWTTLPVAIFSLTDRGNIADGAAL TIVLVAITLLLMMKLERIAKRLGQK
Uniprot No.

Target Background

Function
This protein is likely part of the PhnSTUV complex (TC 3.A.1.11.5) involved in 2-aminoethylphosphonate import. Its primary function is believed to be the translocation of the substrate across the membrane.
Database Links

KEGG: stm:STM0426

STRING: 99287.STM0426

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the putative 2-aminoethylphosphonate transport system permease protein phnV in Salmonella typhimurium?

The phnV protein functions as a permease component within the phosphonate transport system of Salmonella typhimurium, specifically involved in the transport of 2-aminoethylphosphonate (2-AEP) across the bacterial membrane. As part of a multicomponent ABC transporter system, phnV enables the bacterium to utilize phosphonate compounds as alternative phosphorus sources. In recombinant systems, this protein can be exploited for various research applications, including as a target for attenuated vaccine development or for studying bacterial nutrient acquisition mechanisms.

What recombinant expression systems are most effective for studying phnV function?

For optimal phnV expression and functional studies, several expression systems have proven effective:

Expression SystemAdvantagesLimitationsBest Applications
Chromosomal integrationStable expression, single copyLower expression levelsLong-term studies, in vivo models
Plasmid-based expressionHigher copy number, inducible controlRequires antibiotic selectionProtein production, complementation
Gateway-compatible vectorsRapid cloning, multiple tagsMore complex constructionProtein interaction studies
Dual promoter systemsRegulated expression in different environmentsRequires careful optimizationEnvironmental response studies

When selecting an expression system, researchers should consider that membrane proteins like phnV often require specialized approaches to maintain proper folding and insertion into membranes. Systems that have been successful for other Salmonella membrane proteins should be considered, similar to those used in recombinant S. typhimurium constructs that express heterologous proteins .

What are effective protocols for generating recombinant Salmonella typhimurium strains expressing modified phnV proteins?

To generate recombinant S. typhimurium strains with modified phnV, the following methodological approach is recommended:

  • Design Strategy: Begin with precise target identification within the phnV sequence, determining whether to create knockout, epitope-tagged, or overexpression variants.

  • Genetic Modification Method: Lambda Red recombination offers high efficiency for chromosomal integration. For this approach:

    • Design primers with 40-50bp homology to regions flanking the phnV gene

    • Include appropriate selection markers and regulatory elements

    • Perform electroporation of PCR products into S. typhimurium carrying the Lambda Red helper plasmid

    • Select recombinants on appropriate media and verify by PCR and sequencing

  • Expression Verification: Confirm modified phnV expression through:

    • Western blotting (for tagged variants)

    • RT-qPCR to measure transcript levels

    • Functional assays measuring 2-AEP transport

This approach aligns with methodologies used for creating recombinant Salmonella strains that express heterologous proteins, where multiple engineered mutations can be introduced to optimize safety and functionality .

How can researchers effectively study the impact of phnV modifications on Salmonella pathogenicity and invasion?

To assess how phnV modifications affect Salmonella pathogenicity and invasion capabilities, researchers should implement a multi-faceted experimental approach:

  • In vitro Cellular Invasion Assays:

    • Infect epithelial cell lines (e.g., HEp-2, CHO) with wild-type and phnV-modified strains

    • Quantify invasion efficiency using gentamicin protection assays

    • Measure expression of invasion genes using reporter fusions (e.g., to hilA, sipB)

  • Immunological Response Assessment:

    • Evaluate immune recognition of infected cells by cytotoxic T lymphocytes

    • Measure antigen presentation efficiency in professional and non-professional phagocytes

    • Analyze the balance between Th1/Th2 immune responses triggered by different strains

  • Complementation Studies:

    • Restore wild-type phenotypes through expression of functional phnV

    • Use varying promoter strengths to determine dose-dependent effects

    • Assess competitive index in mixed infections with wild-type strains

This methodological framework builds upon established approaches for studying Salmonella invasion mechanisms, drawing from research showing that Salmonella-infected nonphagocytic cells have differential susceptibility to immune system recognition depending on bacterial gene expression patterns .

What methods are optimal for evaluating the interaction between phnV and other components of the phosphonate transport system?

To characterize interactions between phnV and other phosphonate transport system components:

  • Protein-Protein Interaction Analysis:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Co-immunoprecipitation with epitope-tagged variants

    • FRET/BRET approaches for real-time interaction monitoring

  • Structural Studies Pipeline:

    • Membrane protein purification using detergent screening

    • Reconstitution in nanodiscs or liposomes

    • Cryo-EM or X-ray crystallography for structural determination

  • Functional Reconstitution:

    • Development of proteoliposome-based transport assays

    • Fluorescent substrate analogs for transport visualization

    • Electrophysiological measurements in artificial membrane systems

  • Genetic Interaction Mapping:

    • Synthetic genetic array analysis with phn operon components

    • Suppressor mutation screening

    • Epistasis analysis of transport efficiency phenotypes

These methods allow researchers to determine not just the presence of interactions but their functional significance in the context of phosphonate transport and bacterial metabolism.

How can contradictions in phnV functional data be systematically analyzed and resolved?

When researchers encounter contradictory results regarding phnV function, a structured approach to data conflict resolution should be implemented:

  • Contradiction Pattern Analysis:
    Apply the (α,β,θ) classification system to categorize the nature of contradictions, where:

    • α represents the number of interdependent experimental variables

    • β represents the number of contradictory dependencies identified

    • θ represents the minimal number of Boolean rules needed to assess contradictions

  • Experimental Design Matrix:

    Contradiction TypeExperimental ApproachAnalysis MethodResolution Strategy
    Strain-dependentCross-laboratory validation with identical strainsMeta-analysis with random effects modelIdentify genetic background factors
    Condition-dependentStandardized condition testingParameter sensitivity analysisDefine boundary conditions for observations
    Measurement-dependentMethod comparison studiesBland-Altman analysisDevelop calibration standards
    Theoretical framework conflictsMathematical modelingBayesian model comparisonDevelop unifying theoretical framework
  • Standardized Reporting Protocol:

    • Document all experimental parameters comprehensively

    • Report negative and inconclusive results

    • Implement controlled vocabulary for phenotype descriptions

    • Share raw data in community repositories

This systematic approach to contradiction analysis draws from established methods in biomedical data quality assessment, where structured notation helps handle the complexity of multidimensional interdependencies within datasets .

What are the key considerations for designing recombinant phnV constructs for vaccine development applications?

When developing recombinant Salmonella typhimurium strains with modified phnV for vaccine applications, researchers should consider:

  • Attenuation Strategy Selection:

    • Determine whether phnV modification alone provides sufficient attenuation

    • Consider combining with established attenuating mutations (e.g., aroA, phoP/phoQ)

    • Evaluate metabolic burden of modifications on bacterial fitness

  • Immune Response Engineering:

    • Design constructs to achieve balanced Th1/Th2 responses

    • Consider the impact of RpoS status on immunogenicity profiles

    • Engineer strain stability to prevent reversion to virulence

  • Safety Evaluation Framework:

    • Assess survival in human blood and monocytes

    • Measure complement sensitivity

    • Evaluate environmental persistence potential

    • Test clearance kinetics in animal models

  • Immunological Assessment:

    • Measure antigen-specific antibody responses

    • Evaluate cellular immunity development

    • Assess protection against challenge with virulent strains

    • Determine cross-protection potential against heterologous strains

This approach builds on established principles for recombinant attenuated S. Typhi vaccine development, where engineered mutations must balance safety concerns with immunogenicity requirements .

How can advanced omics approaches be integrated to fully characterize the role of phnV in Salmonella phosphonate metabolism and virulence?

To comprehensively characterize phnV's role in Salmonella biology, a multi-omics integration approach should be implemented:

  • Genomic Analysis:

    • Comparative genomics across Salmonella serovars

    • Identification of phnV polymorphisms and their correlation with virulence

    • Evolutionary analysis of phosphonate utilization systems

  • Transcriptomic Profiling:

    • RNA-Seq under phosphate-limited and phosphonate-rich conditions

    • Identification of co-regulated genes

    • Regulatory network mapping through ChIP-Seq for relevant transcription factors

  • Proteomic Characterization:

    • Membrane proteome analysis under varying phosphorus sources

    • Protein-protein interaction mapping through proximity labeling

    • Post-translational modification identification

  • Metabolomic Integration:

    • Phosphonate metabolite tracking using isotope labeling

    • Metabolic flux analysis during infection

    • Identification of phosphonate-derived metabolites

  • Data Integration Framework:

    Data TypeAnalytical ApproachIntegration MethodExpected Insights
    GenomicVariant calling, synteny analysisPhylogenetic profilingEvolutionary context
    TranscriptomicDifferential expression, co-expression networksNetwork inferenceRegulatory mechanisms
    ProteomicQuantitative proteomics, interactome mappingProtein-centric integrationFunctional relationships
    MetabolomicUntargeted and targeted metabolite profilingPathway enrichmentMetabolic consequences
    PhenomicHigh-throughput phenotypingMulti-trait analysisPhenotypic impact

This integrated approach allows researchers to connect genetic variations in phnV to molecular mechanisms and ultimately to phenotypic consequences in both laboratory and infection settings.

What are the critical quality control parameters for validating recombinant phnV expression?

To ensure reliable results when working with recombinant phnV constructs, researchers should implement the following quality control parameters:

  • Expression Verification:

    • Western blotting with specific antibodies or tag detection

    • Mass spectrometry confirmation of protein identity

    • Transcript quantification through RT-qPCR

  • Protein Localization Assessment:

    • Membrane fraction analysis

    • Immunofluorescence microscopy

    • Flow cytometry for surface expression

  • Functional Validation:

    • Transport activity measurement using radioactive or fluorescent substrates

    • Growth complementation in phnV-deficient strains

    • Competitive fitness assessment

  • Structural Integrity:

    • Circular dichroism for secondary structure analysis

    • Limited proteolysis to assess folding

    • Thermal shift assays for stability determination

Each validation step should include appropriate positive and negative controls, and researchers should establish acceptance criteria before experiments begin to avoid post-hoc rationalization of results.

How can researchers optimize experimental conditions to study phnV function in different environmental contexts?

To effectively study phnV function across various environmental conditions relevant to Salmonella lifecycle:

  • Environmental Signal Simulation:

    Environmental ConditionLaboratory SimulationMeasurement ParametersRelevance
    Intestinal environmentpH 5.5-7.5, bile salts, low oxygenGrowth, gene expression, invasionColonization phase
    Macrophage phagosomepH 4.5, nutrient limitation, oxidative stressSurvival, phosphonate utilizationIntracellular phase
    Environmental persistenceSoil/water models, nutrient cyclingLong-term survival, biofilm formationTransmission phase
    Phosphate limitationDefined media with varied P sourcesphnV expression, phosphonate uptakeNutritional adaptation
  • Experimental Design Considerations:

    • Implement factorial designs to capture interaction effects

    • Develop continuous culture systems for steady-state analysis

    • Employ microfluidic devices for single-cell tracking

    • Design competition assays between wild-type and modified strains

  • Analysis Approaches:

    • Use time-series analysis for dynamic responses

    • Apply principal component analysis to identify key variables

    • Implement machine learning for pattern recognition in complex datasets

    • Develop predictive models for phnV activity under untested conditions

This methodological framework enables researchers to characterize phnV function across the full spectrum of environments encountered by Salmonella, from external environments to host tissues.

What are the most effective approaches for troubleshooting failed phnV expression or functional studies?

When facing challenges in phnV expression or functional studies, a systematic troubleshooting approach is essential:

  • Expression Problems Diagnosis Tree:

    • No detectable expression → Check construct sequence → Verify promoter functionality → Assess toxicity → Evaluate mRNA stability

    • Protein detected but non-functional → Check membrane localization → Assess folding → Verify complete translation → Test different tags/fusion partners

    • Inconsistent expression → Evaluate plasmid stability → Check inducer consistency → Assess growth conditions → Monitor metabolic state

  • Functional Assay Troubleshooting:

    • Non-reproducible transport → Standardize substrate preparation → Verify membrane integrity → Check energy source availability → Control for competing transporters

    • High background → Optimize washing protocols → Implement control strains → Reduce non-specific binding → Increase signal-to-noise ratio

    • No detectable activity → Verify assay sensitivity → Test alternative substrates → Assess required cofactors → Consider cryptic regulation

  • Experimental Controls Implementation:

    • Positive controls: Well-characterized membrane transporters

    • Negative controls: Inactive mutants, empty vectors

    • Internal controls: Housekeeping genes, constitutive markers

    • Process controls: Spiked samples, standard curves

This troubleshooting framework provides a structured approach to identifying and resolving common issues in membrane protein research, improving experimental success rates and data reliability.

What emerging technologies are likely to advance our understanding of phnV and related phosphonate transport systems?

Several cutting-edge technologies show promise for transforming research on phnV and phosphonate transport:

  • Advanced Structural Approaches:

    • Cryo-electron tomography for in situ visualization

    • Integrative structural biology combining multiple data types

    • AlphaFold and related AI approaches for structure prediction

  • Single-Molecule Techniques:

    • High-speed atomic force microscopy for conformational dynamics

    • Single-molecule FRET for real-time transport monitoring

    • Nanopore recordings of individual transport events

  • Genome Engineering Advances:

    • CRISPR interference for tunable gene repression

    • Base editing for precise amino acid substitutions

    • In situ mutagenesis during infection

  • Systems Biology Integration:

    • Multi-scale modeling from atomic to cellular levels

    • Whole-cell models incorporating phosphonate metabolism

    • Host-pathogen interaction networks

These technologies will enable researchers to address fundamental questions about phnV function at unprecedented resolution, potentially revealing new applications in vaccine development and antimicrobial strategies.

How might improved understanding of phnV contribute to novel therapeutic or preventive approaches against Salmonella infections?

Enhanced knowledge of phnV biology could lead to several translational applications:

  • Vaccine Development Applications:

    • phnV-attenuated strains as live vaccine vectors

    • Dual-purpose vaccines targeting both Salmonella and heterologous antigens

    • Rational design of multi-component phosphonate transport-based vaccines

  • Antimicrobial Strategies:

    • Phosphonate transport inhibitors as novel antibacterials

    • Phosphonate analogs as "Trojan horse" compounds

    • Combination therapies targeting multiple nutrient acquisition systems

  • Diagnostic Applications:

    • Biomarkers based on phosphonate metabolism

    • Rapid detection of virulent strains through phnV polymorphism analysis

    • Host response signatures to phnV-expressing strains

These applications build on established principles for recombinant Salmonella vaccine development, where strategic modification of bacterial systems can generate strains with optimal balance between safety and immunogenicity .

What collaborative research frameworks would best advance our understanding of phosphonate transport systems across bacterial pathogens?

To accelerate progress in understanding bacterial phosphonate transport:

  • Cross-Disciplinary Collaboration Structure:

    • Core teams combining microbiology, structural biology, immunology, and systems biology

    • Regular data-sharing workshops and standardized protocols

    • Centralized resource repositories for strains, plasmids, and datasets

  • Comparative Pathogen Research Framework:

    • Parallel studies across multiple pathogens (Salmonella, E. coli, Vibrio, etc.)

    • Standardized phenotypic characterization

    • Evolutionary analysis of phosphonate utilization strategies

  • Technology Development Priorities:

    • Improved membrane protein structural determination methods

    • Higher-throughput functional characterization platforms

    • Better in vivo imaging of bacterial nutrient acquisition

  • Open Science Implementation:

    • Preregistration of study designs

    • Data sharing through specialized repositories

    • Open access publication with comprehensive methods reporting

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.