Recombinant Salmonella typhimurium Putative epimerase lsrE (lsrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lsrE; STM4080; Putative epimerase LsrE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
lsrE
Target Protein Sequence
MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCP QFTVGPWAVGQLPQTFIKDVHLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLG QQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQLLAVNPGYGSKMRSSDLHERV AQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM FKVAGDTTFLPSTA
Uniprot No.

Target Background

Database Links

KEGG: stm:STM4080

STRING: 99287.STM4080

Protein Families
Ribulose-phosphate 3-epimerase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the lsrE gene in Salmonella typhimurium and what is its role in the AI-2 quorum sensing pathway?

LsrE is the final protein in the AI-2 quorum sensing pathway that has yet to be fully characterized. It is located at the end of the lsr operon and is homologous to the rpe gene that encodes a ribulose phosphate epimerase . The lsr (LuxS regulated) operon is involved in autoinducer-2 (AI-2) uptake and processing, which is critical for bacterial cell-to-cell communication called quorum sensing. Though characterized as a putative epimerase, its precise function in AI-2 processing remains incompletely understood, with previous research encountering difficulties in functionality determination through bioassays and crystallographic analysis .

How is recombinant Salmonella typhimurium LsrE protein typically expressed and purified for research purposes?

Recombinant LsrE protein is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The methodological approach involves:

  • Cloning: The full-length lsrE gene (encoding amino acids 1-254) is cloned into an expression vector.

  • Expression: Transformation into E. coli followed by induction (commonly using IPTG for T7 promoter-based systems).

  • Purification: Affinity chromatography using nickel or cobalt resins that bind the His-tag.

  • Storage: The purified protein is often stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and can be lyophilized for longer-term storage .

For reconstitution, it is recommended to centrifuge the vial briefly before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage at -20°C/-80°C .

What experimental models are available for studying lsrE function in Salmonella infections?

Several experimental models are used to study lsrE function in the context of Salmonella infections:

  • Cell culture models: Human epithelial cell lines like HeLa and Caco-2 BBE are used to study barrier-disrupting effects of Salmonella proteins .

  • Mouse models:

    • Standard mouse models used for S. typhimurium infections

    • Specialized models such as the TLR11-deficient mice (tlr11 −/−) which are more susceptible to Salmonella infection

    • Transgenic mouse models expressing modified versions of lysozyme that affect Salmonella pathogenicity

  • In vitro bacterial cultures: For studying gene expression and protein production under various conditions, including AI-2 influence on quorum sensing .

When designing experiments, researchers must control for confounding variables and apply appropriate statistical analysis, as described in experimental design guidelines .

What is the relationship between lsrE and other components of the lsr operon in quorum sensing?

The lsr operon consists of multiple genes involved in AI-2 uptake and processing:

Lsr ComponentFunctionRelationship to LsrE
LsrBAI-2 receptor proteinBinds the AI-2 signal molecule for internalization
LsrRTranscriptional repressorControls motility and invasiveness; may regulate lsrE expression
LsrKKinasePhosphorylates internalized AI-2
LsrACDFTransport proteinsFacilitate AI-2 uptake into the cell
LsrEPutative epimeraseFinal processor of AI-2; possibly modifies the signal molecule structure

LsrE likely acts downstream of the other components, potentially modifying the phosphorylated AI-2 molecule. Experimental work with truncated versions of LsrE has been conducted to improve protein stability for crystallographic studies, suggesting challenges in working with the full-length protein .

What methodological approaches can overcome the challenges in crystallographic analysis of lsrE protein?

Previous crystallographic analysis of lsrE has been unsuccessful due to protein stability issues. Researchers can employ the following methodological approaches:

  • Protein truncation strategy: Identify and remove putatively disordered terminal regions to increase protein stability . This requires:

    • Bioinformatic analysis using disorder prediction tools (e.g., PONDR, DISOPRED)

    • Creation of multiple truncation constructs with varying N- and C-terminal boundaries

    • Expression and solubility screening of truncated variants

  • Crystallization optimization:

    • High-throughput screening of crystallization conditions

    • Use of crystallization chaperones or antibody fragments to stabilize flexible regions

    • Surface entropy reduction by mutating clusters of high-entropy residues to alanines

  • Alternative structural approaches:

    • Cryo-electron microscopy for structure determination without crystals

    • Nuclear magnetic resonance (NMR) for solution structure of smaller domains

    • Small-angle X-ray scattering (SAXS) for low-resolution envelope analysis

  • Functional complex formation: Co-crystallization with binding partners or substrates to stabilize the protein in a functional conformation.

How can contradictory data about lsrE function be reconciled through improved experimental design?

When faced with contradictory data about lsrE function, researchers should implement robust experimental designs that address potential confounding factors:

  • Apply quasi-experimental approaches: Use higher-level designs in the hierarchy of quasi-experimental studies to yield more convincing evidence for causal links :

    • Basic: One-group pretest-posttest design

    • Improved: Time series design with multiple measurements before and after intervention

    • Advanced: Removed-treatment design (adding measurements after intervention removal)

  • Control biological variability:

    • Use biological replicates (not just technical replicates)

    • Choose appropriate representative values (mean, median, or mode) for technical replicates

    • Apply GRADE approach for assessing certainty of evidence

  • Reconcile host-pathogen interaction complexities:

    • Consider variability in lsrE function across different infection models

    • Account for host factors such as lysozyme interaction with Salmonella

    • Examine the role of LsrR-mediated quorum sensing in controlling invasiveness

  • Implement retraction analysis framework:

    • Learn from retractions in similar fields to avoid experimental design pitfalls

    • "More attention to statistical strength is a lesson that I've learned..."

    • Ensure sufficient sample size and appropriate controls

What techniques can be used to study lsrE's putative epimerase activity at the biochemical level?

To investigate lsrE's putative epimerase activity, researchers can employ these methodological approaches:

  • Substrate identification:

    • Metabolomic analysis of cells with and without functional lsrE

    • In vitro screening with various sugar phosphates and AI-2 derivatives

    • Computational docking of potential substrates to modeled lsrE structure

  • Enzymatic assays:

    • Coupled enzyme assays that monitor consumption of substrate or production of product

    • Direct monitoring of epimerization using NMR spectroscopy to detect structural changes

    • Polarimetry to detect changes in optical rotation characteristic of epimerases

  • Structural analysis of enzyme-substrate complexes:

    • Co-crystallization with substrate analogs or transition state mimics

    • Hydrogen-deuterium exchange mass spectrometry to identify substrate binding regions

    • Site-directed mutagenesis of putative catalytic residues followed by activity assays

  • Comparative analysis with known epimerases:

    • Sequence and structural comparison with the ribulose phosphate epimerase (rpe)

    • Heterologous complementation experiments

    • Phylogenetic analysis of lsrE homologs across bacterial species

How does lsrE expression influence Salmonella virulence and what are the best methods to measure this relationship?

The relationship between lsrE expression and Salmonella virulence can be assessed through multiple complementary approaches:

  • Gene expression analysis:

    • RT-PCR and real-time RT-PCR to measure lsrE expression levels under different conditions

    • RNA-seq to examine global transcriptional changes associated with lsrE expression

    • Use of appropriate normalization genes (e.g., clpB has been used as it shows consistent expression)

  • Virulence phenotype assessment:

    • Cell invasion assays using epithelial cell lines

    • TEER (transepithelial electrical resistance) measurements to assess barrier disruption

    • Examination of flagella structure and motility (key virulence determinants)

    • Mouse infection models measuring bacterial dissemination and lethality

  • Protein interaction studies:

    • Identify binding partners of LsrE through affinity chromatography and co-immunoprecipitation

    • Assess effects on known virulence factors like InvE, Lpp1, and SipC

  • Quorum sensing pathway analysis:

    • LsrR-regulated gene expression profiling

    • Measurement of SipC levels in infection models correlates with invasiveness

    • Assessment of AI-2 processing in lsrE mutants versus wild-type strains

Table: Experimental models correlating lsrE with virulence parameters

Experimental ApproachKey MeasurementExpected Outcome with lsrE DisruptionReference
TEER assayEpithelial barrier integrityAltered barrier disruption pattern
Mouse infection modelBacterial disseminationChanged pattern of tissue colonization
RT-PCR analysisGene expression patternsAltered quorum sensing response
Motility assayBacterial movementPotential impact on flagellar function
Immunologic responseCytokine productionModified IL-17/IL-23 axis activation

What are the considerations when designing loss-of-function and gain-of-function experiments for studying lsrE?

When designing functional studies of lsrE, researchers should consider:

  • Loss-of-function approaches:

    • Clean deletion mutants (ΔlsrE) using lambda Red recombination system

    • Conditional knockout systems (e.g., temperature-sensitive promoters)

    • CRISPR-Cas9 genome editing for precise mutations

    • Considerations for polar effects on downstream genes

    • Complementation controls to verify phenotype specificity

  • Gain-of-function approaches:

    • Controlled overexpression using inducible promoters

    • Expression of lsrE from plasmids with varying copy numbers

    • Introduction of lsrE into heterologous hosts lacking the gene

    • Expression of LsrE variants with enhanced stability or activity

  • Experimental design controls:

    • Include proper vector-only controls in overexpression studies

    • Use wild-type complementation strains

    • Test multiple independent mutant clones

    • Consider between-subjects or within-subjects designs depending on the context

  • Phenotypic readouts:

    • Growth curves under various conditions

    • Biofilm formation assays

    • Autoinducer-2 processing and uptake measurements

    • Virulence assays in cell culture and animal models

    • Global transcript and proteome analysis

How can researchers isolate and characterize the substrate and product of the LsrE-catalyzed reaction?

To determine the substrate and product of the LsrE epimerase reaction, researchers can employ these methodological approaches:

  • Metabolite isolation:

    • Compare metabolomic profiles of wild-type and ΔlsrE mutants using LC-MS/MS

    • Isolate phosphorylated compounds from cell extracts using phosphate-binding resins

    • Apply stable isotope labeling to track AI-2 processing

  • In vitro reaction reconstitution:

    • Incubate purified recombinant LsrE with potential substrates

    • Analyze reaction mixtures using:

      • High-performance liquid chromatography (HPLC)

      • Mass spectrometry (MS)

      • Nuclear magnetic resonance (NMR)

  • Structural characterization:

    • Determine precise chemical structures of accumulated intermediates in ΔlsrE mutants

    • Use X-ray crystallography to capture enzyme-substrate or enzyme-product complexes

    • Employ computational approaches to predict reaction mechanisms based on homology to known epimerases

  • Functional validation:

    • Test isolated compounds for biological activity in quorum sensing reporter systems

    • Perform complementation assays with purified metabolites

    • Develop specific antibodies or aptamers to detect reaction products in situ

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.