Recombinant Salmonella typhimurium Regulator of sigma E protease (rseP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rseP; STM0223; Regulator of sigma E protease; S2P endopeptidase; Site-2 protease RseP; S2P protease RseP; Site-2-type intramembrane protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
rseP
Target Protein Sequence
MLSILWNLAAFIIALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRYGTEYV IALIPLGGYVKMLDERAEPVAPELRRHAFNNKTVGQRAAIIAAGPVANFIFAIFAYWLVF IIGVPGVRPVIGEITPNSIAAQAQIAPGTELKAVDGIETPDWDAVRLQLVSKIGDQQTTV SVAPFGSDQRQDKTLDLRHWAFEPDKQDPVSSLGIRPRGPQIEPVLSEVQANSAASKAGL QAGDRIVKVDGQPLTQWMKFVTFVRDNPGKPLALEIERQGSALSLTLTPDTKSVNGKAEG FAGVVPKIIPLPEEYKTIRQYGPFSAILEATDKTWQLMKLTVSMLGKLITGDVKLNNLSG PISIAQGAGMSAEFGVIYYLMFLALISVNLGIINLFPLPVLDGGHLLFLAIEKLKGGPVS ERVQDFSYRIGSILLVLLMGLALFNDFSRL
Uniprot No.

Target Background

Function

Recombinant Salmonella typhimurium Regulator of sigma E protease (RseP) is a site-2 regulated intramembrane protease (S2P) that cleaves the peptide bond between Ala-108 and Cys-109 within the transmembrane region of RseA. It is part of a regulated intramembrane proteolysis (RIP) cascade, acting on DegS-cleaved RseA to release its cytoplasmic domain. This proteolytic event activates sigma-E (RpoE) activity within the cell.

Database Links

KEGG: stm:STM0223

STRING: 99287.STM0223

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Regulator of sigma E Protease (RseP) in Salmonella typhimurium?

RseP is an essential protease involved in the sigma E (σE) stress response pathway in Salmonella typhimurium. It functions as a PDZ protease that, along with DegS, mediates the sequential proteolysis of the anti-sigma factor RseA, thereby allowing the release and activation of sigma E. The canonical pathway involves DegS making the initial cut in RseA, followed by RseP processing, but research shows RseP can also act independently in response to certain stressors like acid stress . RseP belongs to a conserved family of membrane proteases found across many bacterial species and plays a crucial role in bacterial adaptation to environmental challenges.

How does sigma E contribute to Salmonella typhimurium pathogenesis?

The alternative sigma factor σE is critically important for Salmonella typhimurium virulence and survival during infection. Studies with σE-deficient mutants demonstrate that this stress response regulator:

  • Is required for resistance to antimicrobial peptides including BPI-derived peptide P2 and murine α-defensin cryptdin-4

  • Plays an essential role in bacterial survival following sudden encounters with various stress conditions

  • Is necessary for intracellular survival and proliferation within both macrophages and epithelial cells

  • Contributes to resistance against oxidative stress (hydrogen peroxide and superoxide) and antimicrobial peptides

  • Is more critical for virulence than individual genes it regulates (such as htrA)

Experimental data shows that rpoE mutants are severely attenuated in mouse models, with significantly higher LD50 values compared to wild-type strains (~1.24 × 10^7 CFU for the rpoE mutant versus <10 CFU for wild-type Salmonella) .

What triggers RseP-mediated activation of sigma E in Salmonella?

RseP-mediated activation of sigma E can be triggered by diverse stimuli:

  • Canonical pathway: Unfolded outer membrane proteins (OMPs) activate DegS, which then cleaves RseA, allowing subsequent cleavage by RseP

  • Acid stress pathway: Low pH can directly activate RseP-dependent processing of RseA without requiring prior DegS activity

  • Environmental stressors: Various environmental challenges including oxidative stress, antimicrobial peptides, and heat shock can induce sigma E activation

  • Host-related stressors: Conditions encountered during infection, particularly in the acidified phagosomal vacuole, trigger sigma E activation through RseP

The acid-dependent activation pathway is particularly significant as it represents a non-canonical mechanism that is independent of unfolded OMP signals or DegS protease but critically requires the PDZ domain of RseP .

What experimental approaches are most effective for studying RseP function in Salmonella typhimurium?

Several complementary methodologies have proven valuable for RseP research:

Genetic Manipulation Techniques:

  • Targeted gene deletion via allelic exchange to create rseP mutants

  • Site-directed mutagenesis to modify specific domains (e.g., the PDZ domain) for functional analysis

  • Construction of reporter fusions to monitor sigma E-dependent gene expression

Protein-Protein Interaction Studies:

  • Bacterial two-hybrid systems similar to those used for MviA interactions, which successfully demonstrated direct protein interactions in vivo

  • Co-immunoprecipitation assays to verify RseP interactions with substrate proteins

  • Fusion of proteins to separate moieties of adenylate cyclase to reconstitute activity upon interaction

Cellular and Infection Models:

  • Macrophage and epithelial cell invasion and survival assays to assess the impact of RseP on intracellular behavior

  • Mouse infection models (both oral and intravenous routes) to evaluate virulence attenuation

  • Ex vivo tissue models such as colonic explants for host-pathogen interaction studies

Stress Response Assays:

  • Acid tolerance response experiments with varying pH conditions

  • Antimicrobial peptide sensitivity testing using compounds like P2 and Crp4

  • Oxidative stress challenge assays with hydrogen peroxide or superoxide-generating compounds

How can researchers effectively produce and purify recombinant RseP for structural and biochemical studies?

Producing functional recombinant RseP presents several challenges that researchers should address:

Expression System Selection:

  • E. coli-based systems have been successfully used for related membrane proteins

  • Consider using strains with reduced protease activity to minimize degradation

  • C41(DE3) or C43(DE3) strains are recommended for membrane protein expression

Construct Design Considerations:

  • Include a cleavable affinity tag (His6, GST, or MBP) to facilitate purification

  • Consider expressing functional domains separately if full-length protein proves challenging

  • Fusion to fluorescent proteins can help monitor expression and localization

Purification Strategy:

  • Use mild detergents (DDM, LMNG, or digitonin) for membrane protein solubilization

  • Employ multiple chromatography steps (affinity, ion exchange, size exclusion)

  • Consider amphipol or nanodisc reconstitution for maintaining protein stability

Activity Verification:

  • Develop in vitro proteolytic assays using synthetic peptides based on RseA sequences

  • Confirm structural integrity through circular dichroism or thermal shift assays

  • Validate function through complementation of rseP-deficient strains

What are the key considerations when designing experiments to study acid-induced RseP activity?

When investigating the acid-dependent activation of RseP, researchers should consider:

pH Control and Monitoring:

  • Precisely calibrate and continuously monitor pH throughout experiments

  • Use appropriate buffers with stable buffering capacity at the desired pH range

  • Account for potential local pH variations in microenvironments

Experimental Design Parameters:

  • Include appropriate controls (canonical pathway activation, DegS-independent controls)

  • Temporally resolve activation steps to distinguish immediate versus secondary effects

  • Examine both acute and prolonged acid exposure to capture different response phases

Domain-Specific Analysis:

  • Focus on the PDZ domain, which has been shown to be indispensable for acid induction

  • Generate point mutations in key residues that might mediate pH-dependent conformational changes

  • Investigate potential differences in interaction between RseA and the RseP PDZ domain under varying pH conditions

Physiological Relevance:

  • Design experiments that mimic conditions encountered in the phagosomal vacuole

  • Consider the combined effects of acid stress with other relevant stressors (oxidative stress, antimicrobial peptides)

  • Validate findings in cellular infection models that recapitulate host-pathogen interactions

How does understanding RseP function contribute to vaccine development strategies?

The role of RseP in sigma E activation has significant implications for vaccine development:

Live Attenuated Vaccine Design:

  • Targeting RseP function can create attenuated strains with reduced virulence while maintaining immunogenicity

  • The relationship between RpoS status and immunogenicity of live Salmonella enterica vaccines suggests similar approaches could be applied to RseP

Immunological Considerations:

  • RpoS+ vaccines have been shown to induce a balanced Th1/Th2 immune response, while RpoS- strains induce a strong Th2 response

  • Similar manipulation of the sigma E pathway through RseP modulation might allow fine-tuning of immune responses

Safety and Efficacy Balance:

  • Recombinant attenuated S. Typhi vaccines (RASTyV) with engineered mutations have demonstrated an optimal balance between safety and immunogenicity

  • Comparative data from clinical trials:

Strain TypeSafety ProfileImmunogenicityProtection Against Challenge
RpoS+ RASTyVHighBalanced Th1/Th2High protection (significant)
RpoS- RASTyVHighStrong Th2-biasedModerate protection
Wild-typePoorStrongHigh protection

This data suggests that similar approaches targeting RseP could yield vaccines with desirable safety and efficacy profiles .

What role does RseP play in Salmonella antimicrobial resistance mechanisms?

Research indicates that RseP and the sigma E pathway contribute significantly to antimicrobial resistance:

Antimicrobial Peptide Resistance:

  • σE-deficient mutants show increased susceptibility to antimicrobial peptides like P2 and Crp4

  • The sigma E pathway regulates genes involved in maintaining outer membrane integrity, crucial for resistance to cationic antimicrobial peptides

Stress Response Integration:

  • RseP-mediated sigma E activation helps bacteria survive acid stress, which is encountered both in the host and during antibiotic treatment

  • This pathway potentially contributes to Salmonella survival during antibiotic treatment that induces envelope stress

Clinical Implications:

  • Multidrug-resistant Salmonella outbreaks are increasingly common, with strains showing resistance to first-line antibiotics

  • Recent outbreaks have involved strains with decreased susceptibility to ciprofloxacin and resistance to multiple other antibiotics

  • The sigma E pathway may contribute to stress adaptation during antibiotic exposure, potentially supporting persistence during treatment

How do RseP-dependent mechanisms differ between Salmonella and other enteric pathogens?

Comparative analysis reveals important differences in RseP function across bacterial species:

Pathway Conservation and Divergence:

  • While the core components (RseP, RseA, and sigma E) are conserved across gram-negative bacteria, significant functional differences exist

  • Unlike E. coli, σE is not required for growth and survival of S. typhimurium at high temperatures, indicating divergent roles

  • The acid-stress activation pathway appears to be particularly important in Salmonella, possibly related to its need to survive the acidified phagosome

Physiological Impact:

  • In Salmonella, rpoE mutants display specific defects in carbon source utilization beyond glucose

  • Salmonella employs the sigma E pathway during chemotactic responses that enable efficient tissue invasion, a critical virulence trait

Evolutionary Considerations:

  • Phylogenetic analysis based on whole genome sequencing reveals that closely related strains can exhibit different virulence properties

  • These differences suggest species-specific adaptations in stress response systems including the RseP-sigma E pathway

What are the emerging approaches for targeting RseP in antimicrobial development?

Several promising strategies are emerging:

Small Molecule Inhibitors:

  • Structure-based design of inhibitors targeting the catalytic site of RseP

  • Allosteric modulators that could prevent conformational changes needed for RseP activation

  • Peptide mimetics based on RseA that could competitively inhibit RseP function

Combination Therapy Approaches:

  • Pairing conventional antibiotics with RseP inhibitors to prevent stress adaptation

  • Targeting multiple components of the sigma E pathway simultaneously to prevent compensatory mechanisms

Delivery Strategies:

  • Nanoparticle-based delivery systems to improve inhibitor penetration through the bacterial envelope

  • Prodrug approaches that become activated in bacterial-specific microenvironments

Translational Challenges:

  • Developing inhibitors with sufficient specificity to avoid effects on host metalloproteases

  • Ensuring adequate penetration through the gram-negative cell envelope

  • Addressing potential resistance mechanisms that might emerge

How might systems biology approaches advance our understanding of RseP in the context of the bacterial stress response network?

Systems biology offers powerful tools for investigating RseP within its broader network:

Multi-omics Integration:

  • Combining transcriptomics, proteomics, and metabolomics to map the complete response network

  • Identifying feedback loops and regulatory circuits involving RseP and sigma E

Network Modeling:

  • Developing mathematical models of the sigma E pathway that incorporate RseP activity under different conditions

  • Predicting system behavior under various stresses and perturbations

Single-cell Analyses:

  • Investigating cell-to-cell variability in RseP-dependent responses using single-cell RNA-seq and time-lapse microscopy

  • Understanding how heterogeneity in RseP activity might contribute to bacterial population survival

Synthetic Biology Approaches:

  • Constructing synthetic circuits to dissect RseP function in simplified systems

  • Using optogenetic tools to achieve temporal control over RseP activation

What are the implications of acid-responsive RseP activation for Salmonella adaptation during infection?

The acid-responsive pathway has significant implications for infection biology:

Host Niche Adaptation:

  • Acid activation of RseP allows rapid sigma E induction upon entry into the acidified phagosome

  • This potentially provides a critical survival advantage during the early stages of infection

Virulence Regulation:

  • The RseP-dependent pathway likely coordinates virulence factor expression in response to host-derived signals

  • σE-deficient mutants show reduced survival in acidified phagosomal vacuoles

Therapeutic Implications:

  • Blocking acid-induced RseP activation might represent a strategy to prevent adaptation to the intracellular environment

  • Such approaches could potentially reduce bacterial persistence without selecting for conventional antibiotic resistance

Research Priorities:

  • Further characterizing the molecular mechanism of acid sensing by RseP

  • Identifying the full complement of genes regulated specifically through this non-canonical pathway

  • Determining how this pathway intersects with other acid response systems in Salmonella

How can researchers reconcile conflicting data regarding RseP function across different experimental systems?

When confronting contradictory findings, consider these methodological approaches:

Standardization Strategies:

  • Establish consistent strain backgrounds for comparative studies

  • Define standard environmental conditions that minimize variability

  • Develop benchmark assays for RseP activity that can be replicated across laboratories

Systematic Comparison Approaches:

  • Direct side-by-side testing of strains and conditions when contradictions arise

  • Meta-analysis of published data with attention to methodological differences

  • Collaborative cross-laboratory validation studies

Technical Considerations:

  • Evaluate protein tagging strategies that might affect RseP function differently

  • Consider the impact of growth media composition on stress response pathways

  • Assess whether in vitro findings translate to more complex in vivo systems

What technical challenges must be overcome to accurately study RseP dynamics in real-time during infection?

Real-time monitoring of RseP activity during infection presents several challenges:

Reporter System Development:

  • Design of sensitive reporters that can detect RseP activity without disrupting function

  • Development of non-invasive readouts compatible with intracellular bacteria

  • Creation of temporally resolved systems that capture rapid activation dynamics

Imaging and Detection Limitations:

  • Overcoming the challenges of visualizing processes within bacteria inside host cells

  • Achieving sufficient spatial resolution to distinguish membrane-localized events

  • Maintaining bacterial viability during long-term imaging

Physiological Relevance:

  • Ensuring that experimental systems recapitulate the complex environmental conditions of infection

  • Accounting for host cell heterogeneity and its impact on bacterial responses

  • Balancing the need for simplified systems with biological complexity

Proposed Solutions:

  • Application of advanced microscopy techniques like super-resolution imaging

  • Development of split fluorescent protein complementation systems specific to RseP activity

  • Utilization of microfluidic systems to control and monitor the microenvironment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.