Recombinant Salmonella typhimurium Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism

GlpG mediates intramembrane proteolysis through a rate-driven process :

  1. Substrate Recognition: Targets orphan subunits of multiprotein complexes (e.g., hydrogenase-2, formate dehydrogenases) when unpartnered .

  2. Cleavage Activation: Helix-destabilizing residues in substrate TMDs facilitate unwinding, enabling catalytic dyad access .

  3. Quality Control: Cleaves non-functional membrane proteins, initiating their degradation and maintaining proteostasis .

Recombinant Production and Characterization

Recombinant GlpG from S. typhimurium is produced in E. coli expression systems, with the following properties :

AttributeDetail
UniProt IDQ8ZLH5
Expression RegionAmino acids 1–276 (full-length protein)
TagDetermined during production (commonly His-tag or GST)
StorageTris-based buffer with 50% glycerol; store at -20°C/-80°C
Purity>85% (SDS-PAGE)
Activity ValidationCleavage of model substrates (e.g., TatA TMD) confirmed via Western blot

Research Applications

  1. Mechanistic Studies: Used to investigate intramembrane proteolysis kinetics and membrane-dependent substrate specificity .

  2. Drug Discovery: Explored as a target for antimicrobial agents due to its role in bacterial virulence .

  3. Structural Biology: Crystallized to resolve active-site dynamics and substrate-binding mechanisms .

Key Research Findings

  • Substrate Specificity: GlpG selectively cleaves orphan HybA (hydrogenase-2 subunit) and FdnH (formate dehydrogenase subunit) only when uncomplexed .

  • Catalytic Mutants: Inactive variants (e.g., GlpG S201A) are used as controls to validate proteolytic activity .

  • Evolutionary Conservation: Rhomboid-mediated quality control is conserved across bacteria and eukaryotes, highlighting GlpG’s biological relevance .

Future Directions

Current research focuses on:

  • Engineering thermostable GlpG variants for industrial applications.

  • Screening inhibitors targeting its catalytic dyad for antibiotic development .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own preparation.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
glpG; STM3524; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links

KEGG: stm:STM3524

STRING: 99287.STM3524

Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the rhomboid protease GlpG and what is its significance in Salmonella research?

Rhomboid proteases like GlpG are intramembrane proteases that hydrolyze substrate peptide bonds within the lipid bilayer. These enzymes are crucial for a wide range of biological processes. The bacterial intramembrane protease GlpG serves as one of the model systems for structural investigations of the rhomboid family . In Salmonella research, studying GlpG contributes to our understanding of bacterial membrane protein dynamics and function. Similar to other proteins in Salmonella (such as GlpE), membrane proteins may contribute to virulence mechanisms, though the specific role of GlpG in Salmonella virulence requires further investigation .

How does GlpG function in bacterial membranes?

GlpG functions as an intramembrane protease in bacterial membranes, cleaving substrate proteins within the lipid bilayer. Solid-state NMR spectroscopy studies of enzymatically active GlpG in native-like lipid environments have confirmed the presence of water molecules in the catalytic cavity, which is essential for its hydrolytic activity . The protein exhibits a dynamic gating mechanism, primarily involving the N-terminal part of transmembrane helix 5 (TM5) and the adjacent loop L4. Relaxation dispersion experiments suggest that TM5 exchanges between open and closed conformations, which likely regulates substrate access to the catalytic site .

What techniques are commonly used to study recombinant GlpG?

Several methodologies are used to study recombinant GlpG:

  • Solid-state NMR spectroscopy - Allows detailed investigation of protein structure and dynamics in a native-like lipid environment

  • Proton-detected experiments - Used to confirm the presence of water molecules in the catalytic cavity

  • Secondary chemical shift analysis - Reveals structural features such as the kink in TM5

  • Dynamics measurements - Identifies dynamic hotspots in the protein structure

  • Relaxation dispersion experiments - Detects conformational exchange between different protein states

For Salmonella research specifically, genetic approaches using barcoded libraries (as employed with other Salmonella proteins) could potentially be adapted to study GlpG function in vivo .

How can one optimize expression and purification of recombinant Salmonella typhimurium GlpG?

Expression System Selection:
Choose expression systems appropriate for membrane proteins, such as E. coli C41(DE3) or C43(DE3) strains that are engineered for membrane protein expression. For Salmonella proteins specifically, consider:

  • Using pET-based vectors with a hexahistidine tag for purification (similar to the approach used for other recombinant proteins)

  • Employing cell-free expression systems for difficult-to-express membrane proteins

  • Testing different fusion tags (MBP, SUMO) to improve solubility

Purification Protocol:

  • Membrane isolation by ultracentrifugation after cell lysis

  • Solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

  • Immobilized metal affinity chromatography (IMAC) with gradient elution

  • Size exclusion chromatography for final purity

  • Reconstitution into proteoliposomes or nanodiscs for functional studies

Quality Assessment:

  • SDS-PAGE analysis under reducing conditions to verify purity and integrity

  • Western blotting to confirm identity

  • Activity assays to verify functional state

What experimental approaches can be used to study GlpG substrate specificity in Salmonella?

In vitro substrate profiling:

  • Develop a fluorogenic peptide library derived from potential Salmonella membrane proteins

  • Measure cleavage efficiency using fluorescence resonance energy transfer (FRET)-based assays

  • Analyze cleavage sites by mass spectrometry to determine consensus sequences

In vivo approaches:

  • Create a GlpG knockout strain using CRISPR-Cas9 genome editing in Salmonella

  • Perform comparative proteomics between wild-type and knockout strains to identify accumulated substrates

  • Validate candidates using epitope-tagged constructs and monitoring their processing

Structural determinants of specificity:

  • Generate point mutations in the active site or gating helix based on the identified kink in TM5

  • Analyze how these mutations affect substrate recognition using in vitro cleavage assays

  • Correlate with conformational dynamics data from NMR studies

How can the dynamics of GlpG be studied in the context of Salmonella infection models?

Infection model development:
Based on established Salmonella research methodologies, GlpG dynamics during infection could be studied using:

  • Murine models similar to those used for studying Salmonella population dynamics

  • Cell culture infection models using epithelial cells or macrophages

  • Creation of Salmonella strains expressing tagged or mutant versions of GlpG

Data collection approaches:

  • Tissue-specific proteomics to track GlpG expression and processing during infection

  • Comparative analysis of wild-type versus GlpG mutant strains for virulence phenotypes (similar to methods used for GlpE studies)

  • Real-time monitoring of protein dynamics using fluorescent reporter systems

What are common challenges in studying membrane-embedded rhomboid proteases like GlpG?

Technical Challenges and Solutions:

ChallengeSolution ApproachMethodological Details
Low expression yieldsOptimize codon usage for Salmonella proteinsAdapt codons to the expression host while maintaining critical Salmonella-specific codons
Protein aggregationScreen detergent conditionsTest a panel of detergents including DDM, DM, LMNG, and GDN at varying concentrations
Loss of activity during purificationInclude stabilizing lipidsSupplement buffers with E. coli polar lipid extract during purification
Structural heterogeneityNanodiscs reconstitutionUse MSP1D1 scaffold protein with defined lipid compositions to create homogeneous samples
Limited substrate identificationProximity labeling approachesEmploy APEX2 fusion constructs to identify proteins in proximity to GlpG in vivo

How can researchers distinguish between the roles of different Salmonella membrane proteins (GlpG vs. GlpE) in virulence studies?

Creating precise genetic constructs is essential for distinguishing the functions of different Salmonella membrane proteins:

  • Generate single and double deletion mutants (similar to the glpE and pspE studies)

  • Create complementation strains with controlled expression levels

  • Design domain-swap chimeras between GlpG and other membrane proteins to identify functional domains

Experimental approach:

  • Challenge mice with various mutant strains using established protocols

  • Quantify bacterial burden in different organs using CFU enumeration

  • Track population dynamics using barcoded Salmonella libraries as described in recent studies

  • Perform competitive infection assays between wild-type and mutant strains

  • Analyze compartmentalization patterns similar to those observed in Salmonella dissemination studies

What controls should be included when studying GlpG activity in reconstituted systems?

Essential controls for GlpG activity assays:

  • Negative controls:

    • Catalytically inactive GlpG mutant (S201A)

    • Heat-denatured enzyme

    • Non-relevant membrane protein of similar size

  • Positive controls:

    • Well-characterized rhomboid substrate (e.g., TatA from E. coli)

    • Commercial rhomboid protease with known activity

  • System validation:

    • Verification of proper membrane incorporation using flotation assays

    • Confirmation of correct orientation in proteoliposomes using protease protection assays

    • Assessment of lipid composition effects by varying lipid mixtures

How does the newly discovered kink in TM5 of GlpG relate to its gating mechanism?

The kink in the central part of the gating helix TM5, revealed by secondary chemical shift analysis in solid-state NMR studies, provides critical insights into GlpG's gating mechanism . This structural feature likely facilitates the conformational exchange between open and closed states observed in relaxation dispersion experiments.

Structural implications:

  • The kink may serve as a hinge point that allows partial unwinding of TM5 during substrate gating

  • This structural feature could explain how water molecules access the catalytic site despite being within the hydrophobic membrane environment

  • The dynamic hotspot at the N-terminal part of TM5 and the adjacent loop L4 suggests this region undergoes significant conformational changes during the catalytic cycle

Experimental approaches to investigate the kink:

  • Site-directed mutagenesis of residues at the kink position

  • Molecular dynamics simulations comparing wild-type and mutant structures

  • Hydrogen-deuterium exchange mass spectrometry to map solvent accessibility changes

What insights can be gained from comparing GlpG across different bacterial species including Salmonella?

Comparative analysis of GlpG across bacterial species can provide valuable insights:

Evolutionary conservation analysis:

  • Align GlpG sequences from diverse bacterial species including Salmonella

  • Identify conserved catalytic residues versus variable regions that may confer species-specific functions

  • Analyze conservation patterns in the gating helix TM5 and dynamic loop L4

Structural comparison:

  • Map species-specific variations onto the known structural features of GlpG

  • Correlate sequence differences with functional divergence

  • Investigate whether the TM5 kink is conserved in Salmonella GlpG

Substrate specificity differences:

  • Compare predicted or known substrates across species

  • Identify species-specific substrate recognition motifs

  • Design chimeric enzymes to test specificity determinants

How might GlpG function be integrated with other Salmonella virulence mechanisms during infection?

While direct evidence linking GlpG to Salmonella virulence is limited, integration with known virulence pathways can be hypothesized based on research on related proteins:

  • Potential interactions with stress response pathways:
    Similar to the phage-shock protein PspE, GlpG may contribute to stress resistance in host environments

  • Connections to metabolic adaptation:
    Like GlpE of the glycerol 3-phosphate regulon, GlpG might be involved in metabolic adaptations during infection

  • Modulation of membrane composition:
    GlpG could process membrane proteins involved in maintaining membrane integrity under stress conditions

  • Intersection with host defense evasion:
    Processing of surface proteins could potentially alter recognition by host immune systems

Experimental approaches to investigate integration:

  • Transcriptomic analysis comparing expression of glpG with known virulence factors during infection

  • Protein-protein interaction studies using proximity labeling

  • Phenotypic analysis of glpG mutants in various infection models, similar to approaches used for glpE studies

What emerging technologies could advance our understanding of GlpG function in Salmonella?

Cutting-edge methodologies with potential application to GlpG research:

  • Cryo-electron tomography:

    • Visualize GlpG in native bacterial membranes at near-atomic resolution

    • Map spatial distribution during different stages of infection

  • Single-molecule enzyme kinetics:

    • Track individual GlpG molecules using fluorescence techniques

    • Directly observe conformational changes during catalysis

  • Advanced genetic barcoding:

    • Adapt the STAMPR analytical framework used in Salmonella population studies

    • Track GlpG variants during infection to identify advantageous mutations

  • Integrative structural biology:

    • Combine solid-state NMR data with computational modeling

    • Generate comprehensive models of GlpG dynamics in native environments

  • High-throughput substrate screening:

    • Develop proteomic approaches to systematically identify GlpG substrates

    • Use CRISPR-based screens to identify genetic interactions

How might targeting GlpG affect Salmonella pathogenesis?

Based on studies of other Salmonella proteins like GlpE that contribute to virulence , investigating GlpG as a potential target could yield valuable insights:

Potential intervention strategies:

  • Development of specific GlpG inhibitors based on structural information

  • Design of substrate-mimetic compounds that bind to the active site

  • Targeting the dynamic regions of TM5 to lock the enzyme in an inactive conformation

Expected outcomes of GlpG inhibition:

  • If GlpG contributes to stress resistance, inhibition might sensitize Salmonella to host defense mechanisms

  • Disruption of membrane protein processing could affect bacterial survival in specific host niches

  • Combining GlpG inhibition with other treatments might enhance antimicrobial efficacy

Experimental validation approaches:

  • Test GlpG inhibitors in murine infection models similar to those used to study Salmonella population dynamics

  • Analyze changes in bacterial burden and tissue distribution upon treatment

  • Investigate potential synergies with conventional antibiotics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.