Recombinant Salmonella typhimurium Secretion system apparatus lipoprotein SsaJ (ssaJ)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Salmonella typhimurium Secretion system apparatus lipoprotein SsaJ (ssaJ) is a critical structural component of the Salmonella Pathogenicity Island 2 (SPI-2) type III secretion system (T3SS). This lipoprotein plays a central role in the intracellular survival and virulence of S. typhimurium by enabling the translocation of effector proteins into host cells. The SPI-2 T3SS is essential for bacterial persistence within macrophages and evasion of host immune responses, distinguishing it from the SPI-1 T3SS, which mediates epithelial cell invasion .

Role in the SPI-2 T3SS

SsaJ is a core component of the SPI-2 T3SS, forming part of the inner membrane ring that anchors the secretion apparatus to the bacterial membrane . The SPI-2 T3SS is composed of 13 genes (ssaJ, ssaK, ssaL, ssaM, ssaV, ssaN, ssaO, ssaP, ssaQ, ssaR, ssaS, ssaT, ssaU), organized into two operons: ssaJ and ssaK/U . These genes encode components homologous to the Yersinia T3SS, including SsaJ (ortholog of YscJ) .

Interaction with Host Pathways

The SPI-2 T3SS enables S. typhimurium to:

  • Evade host defenses: Excludes NADPH oxidase components from phagosomal membranes, preventing reactive oxygen species (ROS) production .

  • Modify vacuolar trafficking: Effectors like SifA and SseJ manipulate endosomal networks to maintain the Salmonella-containing vacuole (SCV) .

  • Induce cytotoxicity: Effector proteins such as SpvB (ADP-ribosyltransferase) depolymerize actin via SsaJ-dependent secretion .

Virulence Attenuation in ssaJ Mutants

Mutations in ssaJ result in:

  1. Reduced effector secretion: Defective translocation of SPI-1 effectors (e.g., SipC), impairing epithelial cell invasion .

  2. Impaired intracellular survival: Attenuated replication within macrophages and increased susceptibility to host clearance .

  3. Altered cytotoxicity: Loss of SpvB-mediated actin depolymerization and caspase-3 activation in human macrophages .

StudyKey FindingSource
ssaJ mutation in S. typhimuriumDefective SipC secretion; reduced HEp2 cell invasion and RAW 264.7 cytotoxicity
ssaJ mutants in macrophagesROS production in phagosomes containing mutants; impaired bacterial replication
SpvB-SsaJ interactionSsaJ required for SpvB translocation and actin depolymerization in macrophages

Recombinant Production and Purification

Recombinant SsaJ is produced in diverse systems with high purity:

Host SystemPurityApplicationsSource
E. coli≥85%Structural studies, vaccine antigen production
Yeast/Baculovirus≥85%Functional assays, T3SS assembly studies
Mammalian cells≥85%Host-pathogen interaction studies

SsaJ-SpvB Synergy in Macrophage Cytotoxicity

SsaJ is indispensable for SpvB activity:

  • Mechanism: SsaJ enables SpvB secretion into host cytosol, where it ADP-ribosylates actin, causing cytoskeletal disruption .

  • Caspase-3 Activation: SsaJ-dependent SpvB secretion triggers apoptosis in macrophages, a hallmark of S. typhimurium infection .

SPI-2 T3SS and Host Immune Evasion

The SPI-2 T3SS, including SsaJ, subverts host defenses by:

  • Inhibiting ROS production: Excluding flavocytochrome b 558 from phagosomal membranes .

  • Modulating vacuolar trafficking: SifA and SseJ recruit host proteins (e.g., SKIP) to stabilize the SCV .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ssaJ; STM14_1705; Secretion system apparatus lipoprotein SsaJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-249
Protein Length
Full Length of Mature Protein
Species
Salmonella typhimurium (strain 14028s / SGSC 2262)
Target Names
ssaJ
Target Protein Sequence
CDVDLYRSLPEDEANQMLALLMQHHIDAEKKQEEDGVTLRVEQSQFINAVELLRLNGYPH RQFTTADKMFPANQLVVSPQEEQQKINFLKEQRIEGMLSQMEGVINAKVTIALPTYDEGS NASPSSVAVFIKYSPQVNMEAFRVKIKDLIEMSIPGLQYSKISILMQPAEFRMVADVPAR QTFWIMDVINANKGKVVKWLMKYPYPLMLSLTGLLLGVGILIGYFCLRRRF
Uniprot No.

Target Background

Function
A component of the Salmonella pathogenicity island 2 (SPI-2) type III secretion system. It is essential for the secretion of several type III-secreted effectors, including the SpvB exotoxin.
Database Links
Protein Families
YscJ lipoprotein family
Subcellular Location
Cell outer membrane; Lipid-anchor.

Q&A

What is SsaJ and what is its function in Salmonella typhimurium?

SsaJ is a critical structural lipoprotein component of the Type Three Secretion System (T3SS) encoded by Salmonella Pathogenicity Island-2 (SPI-2). Specifically, SsaJ forms the inner ring of the SPI-2 needle complex . This secretion apparatus functions as a molecular syringe that enables Salmonella to inject effector proteins into host cells, which is essential for intracellular survival and virulence. The proper formation of this inner ring by SsaJ provides structural integrity to the entire secretion apparatus, creating a stable channel through which effector proteins can be translocated across the bacterial envelope into the host cell.

What is the relationship between SsaJ and the SPI-2 pathogenicity island?

SsaJ is encoded within the Salmonella Pathogenicity Island-2 (SPI-2), a horizontally acquired genomic region that contains genes essential for Salmonella's intracellular survival and virulence . SPI-2 encodes the complete T3SS machinery, including structural components like SsaJ, regulatory proteins such as SsrA and SsrB, and various effector proteins. The expression of SPI-2 genes, including ssaJ, is specifically activated when Salmonella resides within the acidic environment of the Salmonella-containing vacuole (SCV) inside host cells. Within this regulatory network, SsaJ plays a crucial structural role in assembling the secretion apparatus that delivers effector proteins necessary for modifying the host cell environment.

How is SsaJ expression regulated within Salmonella?

SsaJ expression is primarily regulated by the SsrA/SsrB two-component regulatory system, which is also encoded within SPI-2 . In the acidic environment of the macrophage vacuole, the sensor kinase SsrA phosphorylates the response regulator SsrB. Phosphorylated SsrB (SsrB~P) then relieves H-NS-mediated silencing of virulence genes and activates their transcription, including structural components of the T3SS like ssaJ . This regulatory mechanism ensures that the secretion apparatus is expressed at the appropriate time and location during infection, specifically when Salmonella is within the intracellular environment where the T3SS is needed for survival and replication.

What methods are most effective for studying SsaJ function in laboratory settings?

For comprehensive investigation of SsaJ function, researchers should implement a multi-faceted approach:

Genetic approaches:

  • Generate ssaJ null mutants through targeted gene deletion, similar to studies examining ssaC and ssaJ null strains for biofilm formation capabilities

  • Perform complementation studies by reintroducing the ssaJ gene on an expression plasmid

  • Create point mutations in conserved domains to identify critical functional residues

Structural and localization studies:

  • Fluorescent protein fusions (GFP-SsaJ) for real-time visualization

  • Immunofluorescence microscopy using anti-SsaJ antibodies

  • Cryo-electron microscopy to visualize the assembled secretion apparatus

Functional assays:

  • Macrophage infection models to measure intracellular survival

  • Protein secretion assays to quantify T3SS functionality

  • Host cell response measurements (e.g., cytokine production, cell death)

These methodologies can be combined to provide comprehensive insights into SsaJ's role in Salmonella pathogenesis, from molecular structure to host-pathogen interaction dynamics.

How does mutation of the ssaJ gene affect Salmonella's ability to form biofilms?

Interestingly, experimental evidence indicates that mutations in structural components of the SPI-2 secretion system, including SsaJ, do not significantly impact Salmonella's ability to form biofilms . When ssaC and ssaJ null strains were examined for biofilm formation capability, researchers found that both mutant strains formed biofilms to an extent similar to the wild type strain . This finding suggests that the SPI-2 secretory apparatus and its secreted proteins are not directly involved in SsrB-dependent regulation of Salmonella biofilms.

Instead, biofilm formation is more directly influenced by the SsrB transcriptional regulator through its activation of csgD expression. Specifically, unphosphorylated SsrB can positively regulate biofilm formation by activating csgD expression even in the absence of the structural components of the T3SS like SsaJ . This represents a fascinating divergence of function where SsrB can control two distinct lifestyles: the virulent intracellular state (requiring SsaJ and other T3SS components) and the biofilm state (independent of SsaJ).

What is the relationship between SsaJ and cholesterol accumulation in Salmonella-infected cells?

While SsaJ itself is not directly implicated in cholesterol manipulation, there is a significant connection between the SPI-2 secretion system (of which SsaJ is a component) and cholesterol dynamics in infected cells. Recent research has revealed that:

  • Salmonella infection induces dramatic accumulation of cholesterol in macrophages, with a portion localizing to Salmonella-containing vacuoles (SCVs)

  • The bacterial effector protein SseJ (distinct from SsaJ but also part of the SPI-2 system) triggers cholesterol accumulation through a signaling cascade involving focal adhesion kinase (FAK) and Akt

  • SseJ functions as a RhoA-activated cholesterol acyltransferase that generates cholesterol esters from free cholesterol and localizes to the cytoplasmic face of the SCV during infection

  • This cholesterol accumulation leads to mTORC1 recruitment to SCVs and its hyperactivation, suppressing autophagy and preventing bacterial clearance

The functional relationship between these processes demonstrates how the secretion apparatus (including structural components like SsaJ) and effector proteins work in concert: SsaJ helps form the secretion channel necessary for delivering effectors like SseJ, which then manipulate host cholesterol metabolism to benefit bacterial survival.

What are the optimal conditions for expressing recombinant SsaJ for structural studies?

For successful expression and purification of recombinant SsaJ, researchers should consider the following optimized protocol based on current methodologies for membrane proteins:

Expression system selection:

  • E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Inducible promoter systems with tight regulation (such as the pET system with T7 promoter)

  • Low-temperature induction (16-20°C) to minimize inclusion body formation

Expression conditions:

  • Growth medium: Terrific Broth supplemented with 0.5% glucose

  • Induction at OD600 of 0.6-0.8 with 0.1-0.5 mM IPTG

  • Post-induction growth for 16-20 hours at 18°C

Purification strategy:

  • Membrane fraction isolation through ultracentrifugation

  • Solubilization with mild detergents (DDM, LDAO, or C12E8)

  • Immobilized metal affinity chromatography (IMAC) using His-tagged SsaJ

  • Size-exclusion chromatography for final purification

Alternatively, researchers may consider newer approaches like cell-free expression systems for membrane proteins, which may overcome some challenges associated with traditional expression systems .

How can researchers develop genetic constructs to study SsaJ in different bacterial backgrounds?

Developing effective genetic constructs for studying SsaJ requires careful consideration of several factors:

Design considerations:

  • Codon optimization for the target bacterial species

  • Inclusion of appropriate regulatory elements:

    • Native SsrA/SsrB regulatory system if studying natural regulation

    • Alternative inducible promoters for controlled expression

  • Addition of epitope tags (His, FLAG, etc.) for detection and purification

  • Selection of compatible plasmid backbones with appropriate copy number

Implementation strategies:

  • For modular implementation, develop a compact expression cassette similar to the iLOM-SS design described in recent research

  • Consider using recombinase-based genetic circuits, two-component systems, or quorum sensing circuits for regulated expression

  • Ensure proper translocation signals for membrane localization

Validation approaches:

  • Western blotting to confirm expression

  • Fluorescence microscopy to verify localization

  • Functional assays measuring T3SS activity

  • Complementation of ssaJ mutants to confirm functionality

This modular approach enables researchers to examine SsaJ function across different genetic backgrounds while maintaining proper expression, localization, and integration into the secretion apparatus.

How does SsaJ interact with other components of the Salmonella secretion system?

SsaJ forms the inner ring of the SPI-2 needle complex and interacts with multiple components of the type three secretion system to create a functional secretion apparatus. The key interactions include:

Structural interactions:

  • SsaJ interacts with SsaC, which forms the outer ring of the injectisome

  • Likely forms oligomeric rings through self-interaction

  • Connects with needle filament proteins to create the continuous secretion channel

Functional interaction network:

  • Interactions with cytoplasmic ATPase components that provide energy for secretion

  • Association with chaperones that guide effector proteins to the secretion apparatus

  • Coordination with gatekeeper proteins that regulate substrate specificity

These protein-protein interactions create a sophisticated nanomachine capable of delivering bacterial effectors across multiple membrane barriers into the host cell cytoplasm. The proper assembly of this complex requires precise interactions between SsaJ and other structural proteins to form a functional channel.

How does the phosphorylation state of SsrB affect the expression and function of SsaJ?

The phosphorylation state of SsrB acts as a molecular switch that determines Salmonella's lifestyle and consequently affects SsaJ expression and function:

SsrB~P (phosphorylated state):

  • In the acidic macrophage vacuole, SsrA phosphorylates SsrB

  • SsrB~P relieves H-NS-mediated silencing of virulence genes, including ssaJ

  • Activates transcription of the complete T3SS apparatus

  • Promotes the intracellular virulent lifestyle requiring SsaJ function

  • Directs formation of the SCV and bacterial replication within host cells

Unphosphorylated SsrB:

  • Directs transcription of factors required for biofilm formation

  • Specifically activates csgD (agfD), the master biofilm regulator

  • Promotes the surface-attached multicellular lifestyle

  • Functions as an anti-repressor of H-NS at the csgD promoter

This dual regulatory mechanism allows Salmonella to adapt to different environments by controlling the expression of distinct gene sets, with SsaJ being expressed and functional primarily when SsrB is phosphorylated during intracellular infection.

What experimental approaches can identify potential host cell targets of the SsaJ-dependent secretion system?

To identify host cell targets affected by the SsaJ-dependent secretion system, researchers can employ several sophisticated experimental approaches:

Comparative proteomics:

  • Stable isotope labeling with amino acids in cell culture (SILAC) comparing wild-type vs. ssaJ mutant infections

  • Tandem mass tag (TMT) labeling to quantify proteome changes

  • Phosphoproteomics to identify signaling pathways altered during infection

Transcriptomics:

  • RNA-seq analysis of host cells infected with wild-type vs. ssaJ-deficient Salmonella

  • Single-cell RNA-seq to capture heterogeneity in host cell responses

  • Temporal transcriptome profiling to track infection progression

Imaging approaches:

  • High-content screening to identify phenotypic changes in host cells

  • Live-cell imaging with fluorescent reporters for key cellular processes

  • Super-resolution microscopy to visualize SCV membrane composition changes

Functional genomics:

  • CRISPR-Cas9 screens to identify host factors required for SsaJ-dependent processes

  • siRNA knockdown of candidate host targets

  • Host cell line panels with varied genetic backgrounds

One particularly promising approach would involve studying the cholesterol accumulation phenotype, as research has shown that Salmonella infection induces cholesterol accumulation in macrophages through SPI-2 effectors, with downstream effects on mTORC1 activation and autophagy suppression .

How can SsaJ research inform the development of novel antimicrobial strategies?

Research on SsaJ and the SPI-2 secretion system offers several promising avenues for antimicrobial development:

Direct T3SS inhibition strategies:

  • Small molecule inhibitors targeting the SsaJ inner ring structure

  • Peptide-based inhibitors that disrupt SsaJ assembly into the secretion apparatus

  • Compounds that prevent conformational changes required for secretion

Anti-virulence approaches:

  • Targeting the SsrA/SsrB regulatory system to prevent expression of ssaJ and other virulence factors

  • Inhibitors of cholesterol accumulation to counteract SPI-2 effector functions

  • Activators of host autophagy to overcome Salmonella's inhibition of this clearance mechanism

Vaccine development:

  • Attenuated Salmonella strains with modified ssaJ for reduced virulence but maintained immunogenicity

  • Subunit vaccines incorporating SsaJ epitopes

  • Delivery systems based on non-pathogenic bacteria expressing SsaJ

These strategies leverage our understanding of SsaJ's structural and functional roles to develop interventions that specifically target virulence mechanisms rather than bacterial viability, potentially reducing selective pressure for resistance development.

What role might SsaJ play in the development of recombinant Salmonella as therapeutic delivery vehicles?

The structural and functional properties of SsaJ within the T3SS offer unique opportunities for developing Salmonella-based therapeutic delivery systems:

Protein delivery applications:

  • Modified T3SS with SsaJ variants could deliver therapeutic proteins directly into specific cell types

  • Integration with synthetic biology approaches like iLOM-SS (inducible Leaky Outer Membrane based Secretion System) could enhance delivery efficiency

  • Targeted delivery to cancer cells, exploiting Salmonella's natural tropism for tumors

Engineering considerations:

  • Modifying SsaJ and other T3SS components for altered substrate specificity

  • Creating conditionally activated secretion systems using synthetic gene circuits

  • Combining with inducible promoter systems for controlled therapeutic delivery

Potential therapeutic applications:

  • Delivery of cytokines or immunomodulatory proteins to tumor microenvironments

  • Targeted introduction of genome editing components (CRISPR-Cas9)

  • Controlled release of therapeutic proteins in the gastrointestinal tract

Recent research on bacterial protein secretion systems demonstrates that such engineered systems can be constructed in various genetic circuit architectures, including recombinase-based genetic circuits, two-component systems, and quorum sensing circuits . These approaches could be applied to SsaJ-containing systems for developing sophisticated therapeutic delivery vehicles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.