Recombinant Salmonella typhimurium Secretion system apparatus protein SsaS (ssaS)

Shipped with Ice Packs
In Stock

Description

Expression Systems

ssaS is produced via heterologous expression:

Host OrganismExpression VectorPurification MethodSource
E. colipET28a or similarNi-NTA affinity columns
YeastUndisclosedUndisclosed

Role in Bacterial Pathogenicity

While ssaS-specific studies are sparse, secretion systems in Salmonella are pivotal for:

  • Type III Secretion System (T3SS): Invades host cells via needle-like structures (e.g., PrgI) .

  • Type I Secretion System (T1SS): Excretes large proteins like SiiE into host cells .

ssaS may contribute to structural or regulatory aspects of these systems, though functional data remain unreported.

Diagnostic and Therapeutic Potential

Recombinant ssaS could serve as:

  • Antigen for Immune Studies: Similar to OmpA/D, which elicits CD8+ T-cell responses in reactive arthritis .

  • Tool for Secretion Mechanism Studies: Analogous to SsaS homologs in other pathogens.

Table 2: Comparative Secretion System Components in Salmonella

ProteinSystemFunctionReference
SiiET1SSGiant non-fimbrial adhesin
PrgIT3SSNeedle filament component
SsaSUndeterminedSecretion apparatus role

Research Gaps and Future Directions

Current limitations include:

  • Functional Ambiguity: No studies explicitly link ssaS to secretion pathway regulation or effector protein translocation.

  • Structural Data: No crystallographic or cryo-EM data available.

Future research could explore:

  • Interaction Partners: Co-purification with T3SS/T1SS components.

  • Immunogenicity: Potential as a vaccine target or diagnostic marker.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ssaS; STM1420; Secretion system apparatus protein SsaS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-88
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
ssaS
Target Protein Sequence
MNDSELTQFVTQLLWIVLFTSMPVVLVASVVGVIVSLVQALTQIQDQTLQFMIKLLAIAI TLMVSYPWLSGILLNYTRQIMLRIGEHG
Uniprot No.

Target Background

Function
This protein is a component of the type III secretion system.
Database Links

KEGG: stm:STM1420

STRING: 99287.STM1420

Protein Families
FliQ/MopD/SpaQ family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.