Recombinant Salmonella typhimurium Sensor protein BasS (basS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
basS; parB; pmrB; STM4291; Sensor protein BasS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
basS
Target Protein Sequence
MRFQRRAMTLRQRLMLTIGLILLVFQLISTFWLWHESTEQIQLFEQALRDNRNNDRHIMH EIREAVASLIVPGVFMVSLTLLICYQAVRRITRPLAELQKELEARTADNLAPIAIHSSTL EIESVVSAINQLVTRLTTTLDNERLFTADVAHELRTPLSGVRLHLELLSKTHNVDVAPLI ARLDQMMDSVSQLLQLARVGQSFSSGNYQEVKLLEDVILPSYDELNTMLETRQQTLLLPE SAADVVVRGDATLLRMLLRNLVENAHRYSPEGTHITIHISADPDAIMAVEDEGPGIDESK CGKLSEAFVRMDSRYGGIGLGLSIVSRITQLHQGQFFLQNRTERTGTRAWVLLKKA
Uniprot No.

Target Background

Function
BasS is a member of the two-component regulatory system BasS/BasR. It autophosphorylates and activates BasR through phosphorylation. BasS plays a critical role in bacterial adaptation to the host environment, particularly neutrophils, and consequently contributes to virulence.
Gene References Into Functions
  1. The PmrA/PmrB two-component system regulates lipopolysaccharide modification genes. [Review] PMID: 23799815
  2. Studies indicate that the *E. coli* PmrD protein can activate the PmrA (BasR)/PmrB (BasS) system in *Salmonella*, despite its inability to do so in *E. coli*. This suggests species-specific differences in a regulatory component controlling PmrA-P levels. PMID: 21811415
Database Links

KEGG: stm:STM4291

STRING: 99287.STM4291

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the BasS/BasR system contribute to Salmonella virulence and antimicrobial resistance?

The BasS/BasR two-component system significantly impacts both virulence and antimicrobial resistance through several mechanisms:

  • Lipid A modifications: When activated, BasR induces the transcription of genes involved in modifying lipid A, a component of bacterial LPS. These modifications include adding 4-amino-4-deoxy-l-aminoarabinose (l-Ara4N) and phosphoethanolamine (pEtN) to lipid A phosphates .

  • Antimicrobial peptide resistance: These modifications reduce the negative charge of the bacterial cell surface, decreasing electrostatic attraction between the bacterial membrane and positively charged antimicrobial peptides (including polymyxin antibiotics) .

  • Adaptation to host environment: The system helps Salmonella adapt to conditions inside phagocytes, including acidic pH and exposure to antimicrobial compounds .

  • Role in neutrophil evasion: BasS "plays a role in the adaptation of the organism to the host environment, in particular to neutrophils, and therefore it plays a role in virulence as well" .

Studies have confirmed that BasS/BasR regulation is essential for Salmonella survival within macrophages and successful colonization during infection, with experimental data showing that mutations in this system reduce virulence in mouse infection models .

What genes are regulated by the BasS/BasR system?

The BasS/BasR system regulates several critical genes involved in bacterial survival and antimicrobial resistance:

Gene/OperonFunctionRegulation
ugdSynthesis of UDP-glucuronic acid (precursor for l-Ara4N modification)Induced by BasR
aisAssociated with LPS modificationsInduced by BasR
arnBCADTEFEncodes enzymes for l-Ara4N synthesis and incorporation into lipid AInduced by BasR
eptA-basRSEncodes phosphoethanolamine transferase for pEtN addition to lipid AInduced by BasR
pmrREncodes an inhibitor of LpxT (which adds phosphate groups to lipid A)Induced by BasR
pmrDStabilizes phosphorylated BasRRepressed by BasR

Through STRING database analysis, BasS shows strong functional partnerships with several proteins, most notably BasR (score 0.999), EptA (score 0.997), and PhoP (score 0.994) . These interactions form a sophisticated regulatory network that enables Salmonella to modify its surface properties in response to environmental conditions.

What are the most effective methods for constructing recombinant Salmonella typhimurium expressing BasS?

Constructing recombinant Salmonella typhimurium expressing BasS typically involves these methodological steps:

  • Gene amplification and cloning:

    • Amplify the basS gene using PCR with specific primers containing appropriate restriction sites

    • Clone the amplified gene into a suitable vector (e.g., pUCmT for initial cloning)

    • Verify the sequence through DNA sequencing to ensure no mutations were introduced

  • Transfer to expression vector:

    • Subclone basS into an appropriate expression vector using restriction enzyme digestion and ligation

    • For bacterial expression, vectors with strong promoters like T7 are commonly used

    • For eukaryotic expression studies, vectors like pIRES can be employed

  • Bacterial transformation:

    • Transform the recombinant plasmid into E. coli (like DH5α) for amplification

    • Screen positive transformants using PCR and restriction enzyme digestion

    • For methylation decoration, transform into S. typhimurium LB5000 using calcium chloride

    • Extract the plasmid and transform into the final host strain (e.g., SL7207) by electroporation

  • Stability assessment:

    • Culture the transformed bacteria for multiple generations (80+ generations)

    • Extract plasmid DNA periodically to verify construct stability

    • Confirm presence of the basS gene through PCR and restriction enzyme analysis

  • Expression verification:

    • Analyze protein expression using SDS-PAGE and Western blot with anti-BasS antibodies

    • Confirm functionality through appropriate activity assays

This methodology has been successfully employed to create stable recombinant Salmonella strains carrying various genes with maintained expression over multiple generations .

What are the optimal conditions for expressing and purifying recombinant BasS protein?

Optimal expression and purification of recombinant BasS protein requires careful attention to several critical parameters:

Expression conditions:

  • Host selection: E. coli is the preferred expression system

  • Fusion tags: N-terminal His-tag has been successfully used for BasS expression and purification

  • Expression vector: pET or similar vectors with controllable expression are recommended

  • Induction parameters: Optimize IPTG concentration, temperature, and duration for membrane protein expression (typically lower temperatures of 16-25°C are better for membrane proteins)

  • Growth media: Rich media like TB (Terrific Broth) supplemented with appropriate antibiotics

Purification protocol:

  • Cell lysis: French press or sonication in buffer containing protease inhibitors

  • Membrane extraction: Detergent selection is critical (common options include DDM, LDAO, or Triton X-100)

  • Affinity chromatography: IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA resin for His-tagged BasS

  • Further purification: Size-exclusion chromatography to obtain homogeneous protein

  • Quality assessment: SDS-PAGE, Western blot, and activity assays to confirm purity and functionality

Storage considerations:

  • Buffer composition: Tris/PBS-based buffer, pH 8.0 with 6% trehalose

  • Glycerol addition: 50% glycerol final concentration recommended for long-term storage

  • Aliquoting: Create single-use aliquots to avoid repeated freeze-thaw cycles

  • Storage temperature: Store at -20°C/-80°C for long-term storage; working aliquots at 4°C for up to one week

The commercially available recombinant BasS protein (catalog numbers RFL3251SF and CSB-CF330603SXB) is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE .

How can researchers validate the functionality of recombinant BasS protein in vitro?

Validating the functionality of recombinant BasS protein requires assessing its key biochemical activities:

  • Autophosphorylation assay:

    • Incubate purified BasS with [γ-32P]ATP

    • Detect phosphorylation by autoradiography or phosphor-imaging

    • Quantify time-dependent incorporation of phosphate

    • Controls should include a catalytically inactive BasS mutant (H→A mutation at the conserved histidine)

  • Phosphotransfer to BasR:

    • Combine pre-phosphorylated BasS with purified BasR

    • Monitor phosphate transfer from BasS to BasR over time

    • Analyze by SDS-PAGE followed by autoradiography

    • Controls should include time-zero samples and samples without BasR

  • Signal sensing validation:

    • Assess autophosphorylation rates under different conditions (pH, Fe3+ concentration)

    • Compare baseline activity versus activity in presence of potential signals

    • Structural changes can be monitored using circular dichroism or fluorescence spectroscopy

  • DNA binding assays with phosphorylated BasR:

    • Perform electrophoretic mobility shift assays (EMSA) with BasR phosphorylated by BasS

    • Use DNA fragments containing known BasR binding sites from promoters of regulated genes

    • Controls should include unphosphorylated BasR and non-specific DNA fragments

  • Reporter gene assays:

    • Create reporter constructs with BasR-regulated promoters (e.g., from arnB or pmrC)

    • Co-express BasS and BasR with the reporter in a heterologous system

    • Measure reporter activity under different conditions

    • Compare wild-type BasS with mutant versions

These validation methods ensure that recombinant BasS retains both its enzymatic activity (kinase function) and signal-sensing capabilities, confirming that the protein is properly folded and functional for further studies.

How can BasS protein be utilized in vaccine development strategies?

BasS protein offers several promising applications in vaccine development strategies against Salmonella infections:

  • Attenuated live vaccine vectors:

    • Engineered Salmonella strains with modified BasS can serve as attenuated live vaccine vectors

    • These strains maintain immunogenicity while having reduced virulence

    • Example methodology: Recombinant attenuated Salmonella typhimurium DNA vaccines have been successfully constructed carrying H. pylori ureB and mouse IL-2 genes

    • Protocol involves transforming attenuated Salmonella strains (e.g., SL7207) with recombinant plasmids encoding target antigens

  • Subunit vaccine development:

    • Recombinant BasS protein or specific domains can be used as vaccine components

    • The periplasmic sensing domain may be particularly useful as an immunogen

    • Potential for eliciting antibodies that interfere with BasS signaling, thus reducing bacterial virulence

  • Immunological assessment:

    • Animal models (typically mice) can be immunized orally with 5 × 10^8 live recombinant bacteria

    • Protection can be evaluated through challenge with virulent strains and assessment of bacterial clearance

    • Immune responses can be measured through antibody titers, T-cell responses, and cytokine profiles

  • Adjuvant properties:

    • BasS-regulated LPS modifications alter immune recognition

    • This property could be exploited in vaccine formulations to enhance immunogenicity

  • Combined antigen approach:

    • BasS-expressing strains can be engineered to co-express antigens from other pathogens

    • This strategy has shown success with H. pylori antigens, where recombinant Salmonella expressing UreB and IL-2 demonstrated protective efficacy

    • The rapid urease test positivity rate was significantly reduced in immunized groups (12.5-37.5%) compared to control groups (100%)

These approaches leverage BasS's role in virulence regulation while utilizing Salmonella's natural ability to stimulate both humoral and cell-mediated immunity, making it a valuable platform for vaccine development.

What experimental approaches can identify small molecule inhibitors of BasS activity?

Identifying small molecule inhibitors of BasS activity requires systematic screening and validation approaches:

  • High-throughput screening (HTS) assays:

    • Phosphorylation assays: Measure inhibition of BasS autophosphorylation using non-radioactive methods (e.g., phospho-specific antibodies or fluorescent ATP analogs)

    • FRET-based assays: Develop Förster resonance energy transfer systems to monitor BasS-BasR interactions

    • Reporter-based screens: Use bacterial reporter strains with BasS/BasR-regulated promoters driving luciferase or fluorescent protein expression

  • Fragment-based screening:

    • Use NMR, X-ray crystallography, or surface plasmon resonance to identify small fragments that bind to BasS

    • Optimize these fragments through medicinal chemistry approaches

    • Combine fragments that bind to different sites to create more potent inhibitors

  • Virtual screening:

    • Develop homology models of BasS based on related histidine kinases with known structures

    • Perform in silico docking of compound libraries to identify potential binders

    • Validate top hits experimentally using biochemical and cellular assays

  • Structure-guided design:

    • If structural data becomes available, utilize it for rational design of inhibitors

    • Target the ATP-binding pocket, sensor domain, or BasS-BasR interaction interface

    • Design small molecules based on known ligands or substrates

  • Functional validation assays:

    • Polymyxin susceptibility: Test whether candidate inhibitors restore polymyxin sensitivity in Salmonella

    • Lipid A modification analysis: Analyze lipid A profiles using mass spectrometry to confirm inhibition of BasS-regulated modifications

    • Virulence assays: Assess impact on virulence in cellular and animal infection models

  • Medicinal chemistry optimization:

    • Optimize lead compounds for improved potency, selectivity, and pharmacokinetic properties

    • Develop structure-activity relationships (SAR) to guide further optimization

    • Consider prodrug approaches for compounds targeting the periplasmic domain

These methodological approaches would identify compounds that disrupt BasS signaling, potentially leading to novel antimicrobials that could be used alone or in combination with existing antibiotics to combat resistant Salmonella infections.

How does the BasS/BasR system interact with other two-component systems in regulatory networks?

The BasS/BasR system engages in complex interactions with other two-component systems, forming an intricate regulatory network:

  • Interaction with PhoP/PhoQ system:

    • Hierarchical regulation: PhoP/PhoQ can activate BasS/BasR posttranslationally

    • Molecular mechanism: Under low Mg2+ conditions, PhoP activates transcription of pmrD, whose product stabilizes phosphorylated BasR

    • Temporal coordination: Different environmental signals lead to distinct activation patterns:

      • Low Mg2+: PhoP activates first, promoting LpxT expression (increases lipid A negative charge), followed by BasS/BasR activation

      • Mildly acidic pH: Simultaneous induction of PhoP-activated lpxT and BasS/BasR-activated pmrR genes

  • Cross-regulation with QseB/QseC system:

    • STRING analysis shows moderate functional association between BasS and QseB (YgiX) with a score of 0.970

    • QseB/QseC regulates flagella expression through activation of flhDC transcription

    • This interaction may coordinate motility with surface modifications during infection

  • Integration with NsrR regulon:

    • NsrR responds to nitrosative stress and regulates multiple genes in Salmonella

    • Both systems are activated during host infection and may coordinate responses to different aspects of host immunity

  • Network architecture:

    • Feed-forward loops: Where one system activates another, and both regulate common target genes

    • Negative feedback: Where activation of one system can suppress aspects of another

    • Signal integration nodes: Genes regulated by multiple systems serve as integration points

  • Environmental signal processing:

    • Different systems sense specific environmental cues:

      • BasS/BasR: Fe3+, pH, antimicrobial peptides

      • PhoP/PhoQ: Mg2+ concentration, antimicrobial peptides

      • QseB/QseC: Host hormones, quorum sensing signals

    • This allows Salmonella to integrate multiple environmental inputs into a coordinated response

  • Spatiotemporal dynamics:

    • The kinetics of activation differ between systems

    • This creates a temporal program of gene expression during infection

    • For example, BasS/BasR-mediated lipid A modifications occur with different kinetics depending on the activating stimulus

This complex network enables Salmonella to fine-tune its gene expression in response to the diverse conditions encountered during infection, optimizing bacterial survival and virulence in different host environments.

What are the common challenges in expressing membrane proteins like BasS and how can they be overcome?

Expressing membrane proteins like BasS presents several technical challenges that require specific strategies to overcome:

  • Protein toxicity and low expression levels:

    • Challenge: Overexpression of membrane proteins often leads to toxicity and growth inhibition

    • Solutions:

      • Use tightly controlled inducible promoters (e.g., T7-lac)

      • Lower induction temperatures (16-25°C instead of 37°C)

      • Reduce inducer concentration

      • Consider specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression

      • Use auto-induction media for gradual protein expression

  • Improper membrane insertion and protein folding:

    • Challenge: Membrane proteins may aggregate or form inclusion bodies

    • Solutions:

      • Co-express chaperones like GroEL/GroES

      • Add specific lipids to growth media

      • Include mild solubilizing agents (e.g., low concentrations of detergents)

      • Express fusion proteins with solubility-enhancing tags (MBP, SUMO, etc.)

      • Consider cell-free expression systems with supplied lipids/detergents

  • Extraction and solubilization difficulties:

    • Challenge: Efficient extraction from membranes without denaturation

    • Solutions:

      • Screen multiple detergents (DDM, LDAO, Triton X-100, etc.)

      • Optimize detergent concentration and buffer conditions

      • Consider newer solubilization agents like SMA copolymers or nanodiscs

      • Use gentle extraction methods with optimized ionic strength

  • Protein stability issues:

    • Challenge: Membrane proteins often have reduced stability once extracted

    • Solutions:

      • Add stabilizing agents like glycerol (up to 50% final concentration)

      • Include lipids or cholesteryl hemisuccinate during purification

      • Optimize buffer composition (trehalose has been used successfully)

      • Store in small aliquots to avoid repeated freeze-thaw cycles

  • Purification challenges:

    • Challenge: Obtaining pure, homogeneous protein preparations

    • Solutions:

      • Use affinity tags (His-tag has worked successfully for BasS)

      • Implement multi-step purification (e.g., IMAC followed by size exclusion)

      • Consider on-column detergent exchange during purification

      • Remove aggregates through ultracentrifugation before chromatography

  • Functional verification:

    • Challenge: Confirming that purified protein retains native activity

    • Solutions:

      • Develop robust activity assays (e.g., autophosphorylation)

      • Assess ligand binding capabilities

      • Verify proper oligomeric state (e.g., by native PAGE or analytical ultracentrifugation)

By systematically addressing these challenges, researchers can significantly improve the yield and quality of recombinant BasS protein for structural and functional studies.

How can researchers address issues with BasS protein stability during purification and storage?

Maintaining BasS protein stability during purification and storage requires specialized approaches:

  • Optimization during purification:

    • Buffer composition:

      • Use Tris or phosphate-based buffers at pH 7.5-8.0

      • Include 100-300 mM NaCl to maintain ionic strength

      • Add 5-10% glycerol throughout purification steps

      • Consider adding specific lipids (e.g., E. coli polar lipid extract) at low concentrations

    • Detergent selection:

      • Screen multiple detergents (DDM, LDAO, OG, Triton X-100) for optimal extraction

      • Maintain detergent concentration slightly above critical micelle concentration

      • Consider detergent exchange during purification to find optimal stabilizing conditions

    • Protease inhibition:

      • Add protease inhibitor cocktail during cell lysis

      • Work at 4°C throughout purification

      • Minimize purification time to reduce exposure to proteases

  • Stabilization strategies:

    • Ligand addition:

      • If known ligands exist for BasS, add them during purification

      • ATP analogs or substrate mimics can stabilize the conformation

    • Alternative solubilization platforms:

      • Consider nanodiscs, amphipols, or SMALPs as alternatives to detergent micelles

      • These systems better mimic the native membrane environment

    • Engineered stabilization:

      • Consider fusion constructs or truncated versions for specific studies

      • Introduce disulfide bonds to stabilize specific conformations

  • Optimal storage conditions:

    • Cryoprotectants:

      • Use 6% trehalose as a stabilizing agent

      • Add glycerol to 50% final concentration for freezing

    • Aliquoting strategy:

      • Prepare small single-use aliquots to avoid freeze-thaw cycles

      • Use screw-cap microcentrifuge tubes to prevent sample loss

    • Storage temperature:

      • Store at -20°C/-80°C for long-term storage

      • Keep working aliquots at 4°C for up to one week

      • Avoid repeated freeze-thaw cycles

    • Lyophilization:

      • For commercial preparations, lyophilization with appropriate excipients has been successful

      • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Quality control methods:

    • Functional assays:

      • Periodically test autophosphorylation activity to confirm functionality

      • Compare fresh vs. stored protein to quantify activity loss

    • Structural integrity:

      • Use circular dichroism to monitor secondary structure changes

      • Size exclusion chromatography to detect aggregation

      • Thermal shift assays to assess stability under different conditions

These specialized approaches help maintain BasS protein stability and activity throughout purification and storage, enabling more reliable experimental results in functional and structural studies.

What strategies can overcome challenges in studying the interaction between BasS and BasR proteins?

Studying BasS-BasR interactions presents unique challenges requiring specialized approaches:

  • Co-expression and co-purification strategies:

    • Dual expression systems:

      • Design bicistronic constructs expressing both BasS and BasR

      • Use compatible vectors with different antibiotic markers

      • Consider fusion tags that don't interfere with interaction interfaces

    • Tandem affinity purification:

      • Tag BasS and BasR with different affinity tags (His and Strep/FLAG)

      • Perform sequential purification to isolate only interacting complexes

      • Verify complex formation by size exclusion chromatography

  • In vitro reconstitution approaches:

    • Controlled phosphorylation:

      • Purify BasS and BasR separately

      • Establish conditions for BasS autophosphorylation

      • Monitor phosphotransfer from BasS to BasR using:

        • Radioactive ATP (32P) labeling

        • Phospho-specific antibodies

        • Mass spectrometry to detect phosphorylated peptides

    • Membrane mimetics:

      • Reconstitute BasS into nanodiscs or liposomes

      • Study interaction with BasR in a near-native membrane environment

      • Use lipid compositions mimicking Salmonella inner membrane

  • Biophysical interaction analysis:

    • Surface plasmon resonance (SPR):

      • Immobilize BasS in a lipid environment on sensor chip

      • Measure BasR binding kinetics under different conditions

      • Determine how phosphorylation affects interaction parameters

    • Microscale thermophoresis (MST):

      • Label either BasS or BasR with fluorescent dye

      • Measure interaction in solution without immobilization

      • Determine binding affinities in different buffer conditions

    • Native mass spectrometry:

      • Analyze intact complexes to determine stoichiometry

      • Identify conformational changes upon complex formation

  • Structural biology approaches:

    • Crosslinking mass spectrometry:

      • Use chemical crosslinkers to capture transient interactions

      • Identify interaction interfaces by mass spectrometry

      • Create distance restraints for modeling

    • Cryo-electron microscopy:

      • Image BasS-BasR complexes in different functional states

      • Determine structural changes upon phosphorylation

      • This approach is particularly valuable for membrane proteins

    • FRET-based assays:

      • Label BasS and BasR with appropriate FRET pairs

      • Monitor real-time interactions and conformational changes

      • Study dynamic aspects of the phosphotransfer reaction

  • Genetic and cellular approaches:

    • Bacterial two-hybrid systems:

      • Adapt traditional two-hybrid for membrane proteins like BasS

      • Screen for interface residues by systematic mutagenesis

    • In vivo crosslinking:

      • Incorporate photo-activatable amino acids at potential interfaces

      • Crosslink interacting proteins in living bacteria

      • Identify interaction sites by mass spectrometry

These methodological approaches address the specific challenges associated with studying two-component system interactions, providing researchers with multiple strategies to characterize the BasS-BasR signaling mechanism.

How does the kinetics of BasS/BasR activation influence lipid A modifications and antimicrobial resistance?

The temporal dynamics of BasS/BasR activation have profound effects on lipid A modification patterns and subsequent antimicrobial resistance:

  • Stimulus-specific activation kinetics:

    • Different environmental signals produce distinct temporal patterns of gene expression

    • Low Mg2+ conditions:

      • Initially activates PhoP/PhoQ system

      • PhoP promotes LpxT expression, adding phosphate to lipid A (increasing negative charge)

      • Later, PhoP activates BasS/BasR posttranslationally via PmrD

      • BasS/BasR then induces PmrR (LpxT inhibitor) and l-Ara4N incorporation enzymes

      • Result: Modification primarily with l-Ara4N

    • Mildly acidic pH:

      • Simultaneously induces PhoP-activated lpxT and BasS/BasR-activated pmrR

      • Results in a mixed modification profile (both l-Ara4N and pEtN)

  • Competitive modification processes:

    • Different lipid A-modifying enzymes compete for the same substrate sites

    • Modifications with l-Ara4N reduce LPS negative charge more effectively than pEtN

  • Impact on antimicrobial resistance profiles:

    • Different lipid A modifications confer varying levels of resistance:

      • l-Ara4N provides stronger protection against polymyxin than pEtN

      • The mixed modification profile (l-Ara4N + pEtN) offers intermediate protection

    • The kinetics of activation thus directly influence the degree of resistance

  • Mathematical modeling and experimental validation:

    • Time-course experiments tracking:

      • BasS/BasR phosphorylation state

      • Expression of lipid A-modifying enzymes

      • Lipid A modification profiles (via mass spectrometry)

      • Antimicrobial resistance development

    • Construction of knockout strains for specific pathway components

    • Controlled expression systems to alter the timing of enzyme production

  • Clinical relevance:

    • Different infection microenvironments may trigger different activation kinetics

    • This could explain variable antimicrobial susceptibility patterns in clinical isolates

    • Understanding these dynamics could lead to more effective antibiotic treatment strategies

    • Search result #4 notes emergence of "plasmid-borne as well as chromosomally encoded fluoroquinolone resistance underlying emergences of extensive-drug and pan-drug resistance"

The complex relationship between activation kinetics and lipid A modifications represents a sophisticated mechanism by which Salmonella tailors its surface properties to specific stresses, optimizing survival in diverse host environments.

How might targeting BasS/BasR impact the emergence of antimicrobial resistance in Salmonella?

Targeting the BasS/BasR system presents a promising strategy for combating antimicrobial resistance in Salmonella:

  • Restoration of antimicrobial susceptibility:

    • BasS/BasR inhibitors could restore effectiveness of existing antibiotics:

      • Prevent BasS-mediated lipid A modifications that reduce binding of polymyxins and other cationic antimicrobials

      • Increase bacterial membrane permeability to conventional antibiotics

      • Sensitize resistant strains to host immune defenses

  • Resistance development mechanisms:

    • Global analysis of invasive Salmonella Typhimurium revealed:

      • Six major invasive S. Typhimurium clades across sub-Saharan Africa

      • ST313-L2 clade driving the current pandemic

      • Emergence of "extensive-drug and pan-drug resistance"

    • BasS/BasR regulates critical resistance mechanisms:

      • Lipid A modifications (l-Ara4N and pEtN addition)

      • Adaptation to acidic environments in phagosomes

      • Resistance to host antimicrobial peptides

  • Anti-virulence approach:

    • Targeting BasS/BasR would impair Salmonella's adaptation to host environments without directly killing bacteria

    • This approach may exert less selective pressure for resistance development

    • Focus on pathogen-specific mechanisms rather than conserved cellular processes

    • May be particularly effective when combined with conventional antibiotics

  • Potential targeting strategies:

    • Small molecule inhibitors of:

      • BasS sensor domain to prevent signal detection

      • BasS histidine kinase activity

      • BasS-BasR interaction

      • Downstream lipid A modification enzymes

    • Protein-based inhibitors:

      • Designed binding proteins targeting BasS (similar to approach in search result #3)

      • Peptides mimicking interaction interfaces

  • Impact on evolving resistance landscape:

    • Genomic analysis shows BasS/BasR system is well-conserved across Salmonella lineages

    • Targeting this system could address resistance in multiple clades simultaneously

    • May provide a broader strategy against the diverse Salmonella population structure observed in sub-Saharan Africa, where "at least six invasive S. Typhimurium clades have already emerged"

  • Research priorities:

    • High-throughput screening for BasS/BasR inhibitors

    • Structural studies of BasS to enable rational drug design

    • Investigation of resistance mechanisms to BasS/BasR inhibitors

    • Combination therapies (BasS/BasR inhibitors + conventional antibiotics)

    • Animal models to validate efficacy and resistance development

Targeting this system represents a innovative approach to combat the increasing problem of antimicrobial resistance in Salmonella, particularly in regions like sub-Saharan Africa where invasive Salmonella disease causes significant mortality.

What are the most promising future applications of recombinant BasS protein in developing new antimicrobials?

Recombinant BasS protein offers several innovative pathways for antimicrobial development:

  • Structure-based drug design:

    • High-quality recombinant BasS protein enables structural studies

    • Crystal or cryo-EM structures would reveal:

      • ATP-binding pocket architecture for kinase inhibitor design

      • Signal-sensing domain structures for ligand discovery

      • BasS-BasR interaction interfaces

    • Computational approaches using these structures could identify:

      • Small molecule binding pockets

      • Fragment-based starting points for drug development

      • Structure-activity relationships for lead optimization

  • High-throughput screening platforms:

    • Recombinant BasS protein can be utilized in biochemical assays:

      • ATP consumption/ADP production assays

      • Phosphorylation detection systems

      • Conformational change sensors

    • These assays enable screening of:

      • Chemical libraries (10^5-10^6 compounds)

      • Natural product extracts

      • Peptide/aptamer libraries

  • Vaccine development applications:

    • Recombinant BasS protein as antigen:

      • Potential for generating antibodies that interfere with BasS signaling

      • Focus on extracellular/periplasmic domains as vaccine components

      • Combination with other Salmonella antigens for multivalent protection

    • Use as a carrier protein for heterologous antigens:

      • Similar to successful approaches with recombinant Salmonella expressing H. pylori antigens

      • Potential for broadly protective vaccines

  • Antibody-based therapeutics:

    • Generation of antibodies targeting BasS extracellular domains

    • Development of antibody-antibiotic conjugates for targeted delivery

    • Creation of bispecific antibodies targeting BasS and immune effector cells

  • Diagnostic applications:

    • BasS-specific antibodies for detection of Salmonella

    • Development of BasS activity assays to assess virulence potential

    • Platforms to predict antimicrobial susceptibility based on BasS activity

  • Combination strategies:

    • BasS inhibitors combined with conventional antibiotics:

      • Restore effectiveness of existing antimicrobials

      • Reduce required antibiotic doses

      • Target different aspects of bacterial physiology

    • BasS inhibitors with immune modulators:

      • Enhance host defense mechanisms

      • Prevent immune evasion strategies

      • Create synergistic effects

These approaches leverage recombinant BasS protein as both a direct target and a tool for developing novel antimicrobial strategies, potentially addressing the critical need for new treatments against resistant Salmonella infections that cause significant morbidity and mortality globally.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.