Recombinant Salmonella typhimurium Sensor protein qseC (qseC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipment of the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
qseC; STM3178; Sensor protein QseC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
qseC
Target Protein Sequence
MKLTQRLSLRVRLTLIFLILVSITWAISSFVAWRKTTDNVDELFDTQLMLFARRLSTLDL NEINAPQRMAHTPKKLKHGHIDDDALAFAIFSADGKMLLHDGDNGQDIPYRYRREGFDNG YLKDDNDLWRFLWLNSADGKYRIVVGQEWDYREDMALAIVAAQLTPWLIALPFMLLILLL LLHRELRPLKKLAQALRFRSPESETPLDAKGVPSEVRPLVEALNQLFSRIHSMMVRERRF TSDAAHELRSPLAALKVQTEVAQLSGDDPLSRDKALTQLHAGIDRATRLVDQLLTLSRLD SLNNLQDVAEISLEELLQSAVMDIYHPAQQANIDVRLQLNAHDVIRTGQPLLLSLLVRNL LDNAIRYSPQGSVVDVTLHARSFTVRDNGPGVAPEILTHIGERFYRPPGQSVTGSGLGLS IVRRIATLHGMTVSFGNAAEGGFEAVVSW
Uniprot No.

Target Background

Function
Recombinant Salmonella typhimurium Sensor protein qseC is a member of the two-component regulatory system QseB/QseC. It activates the flagella regulon by activating FlhDC transcription and may activate QseB through phosphorylation.
Gene References Into Functions
  1. QseC is a virulence factor in Salmonella typhimurium. PMID: 27853287
  2. A qseC mutant showed impaired flagellar motility, reduced invasion of epithelial cells, decreased survival within macrophages, and attenuated systemic infection in 129x1/SvJ mice. PMID: 20028809
  3. The adrenergic sensors QseC and QseE were not essential for norepinephrine (NE)-enhanced enteritis, intestinal colonization in calves, or NE-dependent growth in culture, and did not affect virulence factors. PMID: 19884332
  4. This study demonstrated a role for the QseBC quorum-sensing system in S. Typhimurium motility and swine colonization. PMID: 17997077
Database Links

KEGG: stm:STM3178

STRING: 99287.STM3178

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella typhimurium Sensor protein qseC?

Salmonella typhimurium Sensor protein qseC is a membrane-bound histidine sensor kinase found in Gram-negative pathogens, including Salmonella. It functions as a critical component of bacterial quorum sensing systems and plays a significant role in regulating bacterial virulence gene expression . The full-length protein consists of 449 amino acids and can be recombinantly expressed with various tags for research purposes . QseC is encoded by the qseC gene (also known as STM3178) and contains both sensing and kinase domains that enable it to detect environmental signals and transduce them into cellular responses that modulate pathogenicity.

How does qseC contribute to bacterial pathogenesis?

QseC sensor protein contributes to bacterial pathogenesis through multiple mechanisms:

  • Virulence gene regulation: QseC activates the expression of critical virulence genes, including flhDC, sifA, and sopB, which control various pathogenic processes in Salmonella .

  • Motility control: QseC signaling regulates bacterial swimming motility, which is essential for Salmonella to navigate to preferred sites of infection .

  • Invasion capacity: The protein enhances the ability of Salmonella to invade host cells, a crucial step in establishing infection .

  • Intracellular replication: QseC signaling promotes bacterial replication within host cells, allowing the pathogen to multiply and spread .

  • Modulation of host cell death: QseC-dependent processes impact pyroptosis (inflammatory cell death) of infected macrophages, as evidenced by changes in lactate dehydrogenase (LDH) release, caspase-1 activation, and IL-1β production when QseC is inhibited .

Research has shown that inhibition of QseC with specific inhibitors like LED209 significantly reduces these virulence properties, demonstrating the protein's central role in Salmonella pathogenesis.

What are the optimal methods for recombinant qseC protein expression and purification?

For optimal expression and purification of recombinant Salmonella typhimurium qseC protein, researchers should consider the following methodological approach:

  • Expression system selection: E. coli is the preferred heterologous expression system for qseC protein due to its high yield and compatibility . BL21(DE3) or similar expression strains are recommended for membrane proteins.

  • Vector design: Incorporate an N-terminal His-tag or alternative affinity tag to facilitate purification. The full-length sequence (1-449aa) should be cloned into an expression vector with an inducible promoter system .

  • Culture conditions:

    • Grow cells at 37°C until mid-log phase (OD600 ~0.6-0.8)

    • Induce with IPTG (0.1-1.0 mM)

    • Lower temperature to 18-25°C post-induction

    • Continue expression for 16-20 hours

  • Cell lysis and membrane fraction isolation:

    • Disrupt cells by sonication or high-pressure homogenization

    • Separate membrane fraction by ultracentrifugation

    • Solubilize membrane proteins using appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

  • Purification steps:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification if needed

  • Quality control:

    • Verify purity by SDS-PAGE (>90% purity is desirable)

    • Confirm identity by Western blot or mass spectrometry

    • Assess activity through functional assays

This methodological approach should yield functionally active qseC protein suitable for downstream research applications.

What are the recommended storage conditions for recombinant qseC protein?

Based on established protocols for membrane proteins like qseC, the following storage recommendations should be implemented:

Storage FormTemperatureBuffer CompositionAdditivesShelf LifeNotes
Lyophilized powder-20°C to -80°CTris/PBS-based, pH 8.06% Trehalose12+ monthsPreferred for long-term storage
Reconstituted solution4°CTris/PBS-based, pH 8.0NoneUp to 1 weekFor immediate use
Aliquoted solution-20°C to -80°CTris/PBS-based, pH 8.05-50% Glycerol (50% recommended)6+ monthsAvoid repeated freeze-thaw cycles

For optimal stability, consider the following additional recommendations:

  • Store the protein in small aliquots to minimize freeze-thaw cycles, as repeated freezing and thawing significantly reduces protein activity .

  • Prior to opening, briefly centrifuge vials containing lyophilized protein to ensure all material is at the bottom of the tube .

  • For proteins in solution, snap-freeze aliquots in liquid nitrogen before transferring to -80°C for long-term storage.

  • Include protease inhibitors in storage buffers if proteolytic degradation is a concern.

  • Monitor protein stability over time using activity assays or structural analysis techniques.

These storage conditions are designed to maintain protein stability and functional integrity for experimental applications.

What are the optimal reconstitution protocols for lyophilized qseC protein?

For optimal reconstitution of lyophilized qseC protein, follow this step-by-step protocol:

  • Pre-reconstitution preparation:

    • Allow the vial to equilibrate to room temperature (15-25°C)

    • Briefly centrifuge the vial to ensure the protein powder is at the bottom

    • Prepare sterile materials and work in a clean environment to avoid contamination

  • Reconstitution procedure:

    • Add deionized sterile water to achieve a final concentration between 0.1-1.0 mg/mL

    • Gently rotate or swirl the vial until complete dissolution (avoid vigorous shaking or vortexing)

    • Allow the solution to stand for 10-15 minutes at room temperature

    • If necessary, centrifuge briefly to collect any undissolved material

  • Post-reconstitution handling:

    • Add glycerol to a final concentration of 5-50% (50% is recommended) for storage stability

    • Prepare multiple small-volume aliquots to avoid repeated freeze-thaw cycles

    • Use low-protein binding microcentrifuge tubes for aliquoting

  • Quality verification:

    • Verify protein concentration using Bradford or BCA protein assay

    • Confirm protein integrity via SDS-PAGE if sufficient material is available

    • Assess functionality through appropriate activity assays

  • Storage of reconstituted protein:

    • For immediate use: store at 4°C for up to one week

    • For long-term storage: store aliquots at -20°C or preferably -80°C

This methodical approach ensures optimal protein recovery and maintains the structural and functional integrity of the qseC protein for experimental applications.

How can qseC be used in bacterial pathogenesis studies?

Recombinant qseC protein serves as a valuable tool in bacterial pathogenesis research through several methodological approaches:

  • Virulence mechanism investigation:

    • Use purified qseC in binding assays to identify host or environmental molecules that trigger bacterial virulence

    • Employ qseC in phosphorylation assays to characterize signal transduction pathways

    • Conduct structural studies to determine critical binding domains

  • Inhibitor screening and development:

    • Implement high-throughput screening assays using recombinant qseC to identify novel inhibitors

    • Evaluate inhibitor binding kinetics through surface plasmon resonance or isothermal titration calorimetry

    • Assess structure-activity relationships of lead compounds like LED209

  • Host-pathogen interaction studies:

    • Develop cell culture infection models with wild-type and qseC-mutant Salmonella

    • Measure differences in bacterial invasion, replication, and host cell responses

    • Quantify pyroptosis markers such as LDH release, caspase-1 activation, and IL-1β production

  • Experimental design approach:

    • Establish dose-response relationships for qseC-dependent phenotypes

    • Implement appropriate controls including qseC knockout strains and complemented mutants

    • Design time-course experiments to capture the dynamic nature of qseC-mediated processes

  • Validation methods:

    • Use qPCR to quantify expression of qseC-regulated virulence genes (flhDC, sifA, sopB)

    • Employ motility assays to assess functional impacts on bacterial swimming

    • Implement confocal microscopy to visualize bacterial invasion and intracellular localization

These methodological approaches provide researchers with robust frameworks for investigating qseC's role in bacterial pathogenesis, with potential implications for antimicrobial development.

What methods best demonstrate qseC's impact on Salmonella virulence gene expression?

To rigorously demonstrate qseC's impact on Salmonella virulence gene expression, researchers should implement a multi-faceted methodological approach:

  • Transcriptional analysis techniques:

    • RT-qPCR: Quantify expression levels of key virulence genes (flhDC, sifA, sopB) in wild-type versus qseC mutant strains or under qseC inhibition conditions

    • RNA-Seq: Perform genome-wide transcriptional profiling to identify the complete qseC regulon

    • Transcriptional reporter fusions: Create luciferase or fluorescent protein fusions to virulence gene promoters to monitor expression dynamics in real-time

  • Experimental design considerations:

    • Implement time-course experiments to capture temporal regulation patterns

    • Use defined growth conditions that mimic infection environments (e.g., low Mg2+, acidic pH)

    • Include appropriate controls: qseC knockout, complemented strain, and strain treated with specific inhibitors (e.g., LED209)

  • Functional validation approaches:

    • Motility assays: Quantify swimming ability on semi-solid agar plates to assess flhDC expression effects

    • Invasion assays: Measure bacterial entry into epithelial cells to validate expression changes in invasion genes

    • Intracellular replication: Count bacteria inside macrophages at different time points to confirm functional impacts

  • Protein-level confirmation:

    • Western blotting to quantify changes in virulence protein levels

    • Proteomics analysis to identify broader proteomic changes

    • Immunofluorescence microscopy to visualize protein localization changes

  • Data analysis framework:

    • Apply appropriate statistical tests (e.g., t-tests, ANOVA with post-hoc analysis)

    • Use fold-change thresholds (typically >2-fold) to identify biologically significant changes

    • Implement clustering algorithms to identify co-regulated gene sets

By integrating these methodological approaches, researchers can establish robust causal relationships between qseC activity and virulence gene expression patterns in Salmonella typhimurium.

How does qseC blockade affect Salmonella-host cell interactions?

QseC blockade significantly alters Salmonella-host cell interactions through multiple mechanisms, which can be demonstrated using the following methodological approaches:

  • Macrophage infection models:
    Research has shown that qseC inhibition by compounds such as LED209 substantially impacts Salmonella-macrophage interactions. When qseC is blocked:

    • Lactate dehydrogenase (LDH) release from infected macrophages decreases significantly, indicating reduced cell damage

    • Activated caspase-1 levels in macrophages are suppressed, suggesting inhibition of inflammasome activation

    • IL-1β production is reduced, demonstrating dampened inflammatory responses

    • Intracellular bacterial counts decrease, reflecting compromised replication capacity

  • Experimental approaches to quantify these effects:

    • Cell viability assays: Measure macrophage survival using MTT or similar assays

    • Cytotoxicity assays: Quantify LDH release from infected cells at different time points

    • Immunoblotting: Detect cleaved caspase-1 p10/p20 to assess inflammasome activation

    • ELISA: Measure IL-1β secretion in cell culture supernatants

    • Gentamicin protection assays: Count intracellular bacteria at various time points post-infection

  • Visualizing Salmonella-host interactions:

    • Confocal microscopy: Track fluorescently-labeled bacteria within host cells

    • Electron microscopy: Examine ultrastructural changes in Salmonella-containing vacuoles

    • Live cell imaging: Monitor real-time dynamics of bacterial invasion and intracellular movement

  • Experimental design considerations:

    • Use multiple qseC inhibitor concentrations to establish dose-dependent relationships

    • Implement time-course experiments (typically 1, 4, 8, and 24 hours post-infection)

    • Include appropriate controls: untreated infected cells, uninfected cells, and cells infected with qseC mutant Salmonella

This methodological framework enables researchers to comprehensively characterize how qseC blockade modulates Salmonella-host interactions, with important implications for understanding pathogenesis and developing novel therapeutic approaches.

What experimental designs are optimal for studying qseC inhibitors?

When designing experiments to study qseC inhibitors, researchers should implement robust methodological approaches that address multiple aspects of inhibitor activity:

  • In vitro binding and activity assays:

    • Thermal shift assays: Measure changes in protein thermal stability upon inhibitor binding

    • Surface plasmon resonance: Determine binding kinetics (kon, koff) and affinity (KD)

    • Autophosphorylation assays: Quantify inhibition of qseC kinase activity using radiolabeled ATP or phospho-specific antibodies

    • FRET-based assays: Monitor conformational changes upon inhibitor binding

  • Cell-based virulence inhibition models:

    • Implement quasi-experimental study designs with appropriate controls

    • Use multiple pretest-posttest measurements to rule out regression to the mean effects

    • Include nonequivalent dependent variables to strengthen causal inferences

    • Design dose-response experiments with LED209 or other qseC inhibitors

  • Recommended experimental design structure:

    Experimental GroupTreatmentPre-measurementsPost-measurementsControls
    Wild-type SalmonellaqseC inhibitor (multiple concentrations)Growth rate, motility, gene expressionVirulence gene expression, invasion capacity, macrophage infection outcomesVehicle control, inactive analog
    qseC mutantqseC inhibitorSame as aboveSame as aboveComplemented mutant
    Complemented strainqseC inhibitorSame as aboveSame as aboveVehicle control
  • Methodological considerations for data collection:

    • Use time-course experiments to capture dynamic effects of inhibition

    • Implement multiple biological and technical replicates

    • Blind researchers to treatment groups when possible

    • Standardize experimental conditions to enhance reproducibility

  • Statistical analysis approaches:

    • Apply appropriate statistical tests (t-tests, ANOVA with post-hoc tests)

    • Use power analysis to determine adequate sample sizes

    • Consider employing mixed-effects models for time-course data

    • Report effect sizes along with p-values to indicate biological significance

This comprehensive experimental design framework provides a methodologically sound approach to studying qseC inhibitors, allowing researchers to draw strong causal inferences about inhibitor efficacy and mechanisms.

How can researchers address contradictory results in qseC functional studies?

When confronted with contradictory results in qseC functional studies, researchers should implement a systematic approach to resolve discrepancies:

  • Methodological reconciliation strategies:

    • Standardize experimental conditions: Compare protocols in detail, including bacterial strains, growth conditions, and assay parameters

    • Cross-validate key findings: Replicate critical experiments using multiple complementary techniques

    • Implement blinded analysis: Have data analyzed by researchers unaware of experimental conditions

    • Conduct inter-laboratory validation: Collaborate with other research groups to independently verify results

  • Experimental design considerations:

    • Employ hierarchical quasi-experimental designs that help rule out alternative explanations

    • Use multiple pretest measurements to establish baseline trends before intervention

    • Include nonequivalent dependent variables to strengthen causal inferences

    • Design experiments with sufficient statistical power to detect biologically meaningful effects

  • Potential sources of contradictions and solutions:

    Source of ContradictionMethodological SolutionValidation Approach
    Strain differencesUse identical strains or sequence-verify key genesCompare complete genome sequences
    Growth condition variationsStandardize media composition, temperature, and growth phaseMonitor growth curves and cellular physiology markers
    Different qseC inhibitor concentrationsPerform dose-response experimentsMeasure actual inhibitor binding using biophysical methods
    Host cell model differencesUse multiple cell types and primary cellsValidate key findings in animal models
    Analytical technique limitationsApply complementary methods to measure the same parameterCompare sensitivity and specificity of different assays
  • Data analysis and interpretation framework:

    • Conduct meta-analysis when multiple studies are available

    • Weigh evidence based on methodological rigor and reproducibility

    • Consider biological plausibility when interpreting conflicting results

    • Develop testable hypotheses that could explain apparent contradictions

  • Reporting recommendations:

    • Thoroughly document methodological details to enable reproduction

    • Clearly state limitations and potential confounding factors

    • Present both supporting and contradictory evidence

    • Suggest specific experiments to resolve remaining contradictions

By implementing this systematic approach, researchers can effectively address contradictory results in qseC functional studies, leading to more robust and reproducible findings in this important area of bacterial pathogenesis research.

What are emerging methodologies for studying qseC-mediated virulence regulation?

Several cutting-edge methodologies are transforming our understanding of qseC-mediated virulence regulation in Salmonella typhimurium:

  • High-resolution structural approaches:

    • Cryo-electron microscopy: Enables visualization of the full-length qseC protein in various conformational states

    • Hydrogen-deuterium exchange mass spectrometry: Maps inhibitor binding sites and conformational changes

    • Single-particle analysis: Reveals the molecular architecture of qseC-containing signaling complexes

    • Molecular dynamics simulations: Predicts structural changes upon signal recognition or inhibitor binding

  • Advanced genomic and transcriptomic methods:

    • RNA-Seq with differential expression analysis: Provides comprehensive mapping of the qseC regulon

    • ChIP-Seq for downstream transcription factors: Identifies direct regulatory targets in the virulence pathway

    • Single-cell RNA-Seq: Reveals population heterogeneity in qseC-dependent gene expression

    • CRISPR interference screens: Systematically identifies genes involved in qseC signaling pathways

  • Innovative protein-protein interaction technologies:

    • Proximity labeling (BioID, APEX): Identifies the qseC interactome in living bacteria

    • Förster resonance energy transfer (FRET): Monitors dynamic interactions between qseC and signaling partners

    • Split reporter complementation: Validates specific protein-protein interactions in vivo

    • Protein correlation profiling: Maps qseC-containing protein complexes during infection

  • Advanced infection models:

    • Organoid cultures: Provides physiologically relevant host cell environments

    • Microfluidic devices: Enables precise control of infection conditions and real-time monitoring

    • Intravital microscopy: Allows visualization of qseC-dependent processes during infection in live animals

    • Tissue-specific in vivo reporter systems: Monitors qseC-regulated gene expression in different host niches

  • Systems biology approaches:

    • Multi-omics integration: Combines transcriptomics, proteomics, and metabolomics data

    • Network analysis: Identifies regulatory hubs and feedback loops in qseC signaling

    • Machine learning algorithms: Predicts virulence phenotypes based on gene expression patterns

    • Mathematical modeling: Simulates the dynamics of qseC-regulated virulence circuits

These emerging methodologies provide researchers with powerful tools to dissect the complex mechanisms by which qseC regulates Salmonella virulence, potentially leading to novel therapeutic approaches targeting this critical signaling system.

What considerations are important when interpreting qseC protein-protein interaction data?

When interpreting protein-protein interaction (PPI) data involving qseC, researchers should consider several critical methodological and analytical factors:

  • Method-specific considerations:

    • Co-immunoprecipitation: Evaluate antibody specificity and potential for non-specific binding

    • Bacterial two-hybrid systems: Consider limitations for membrane proteins like qseC

    • Cross-linking mass spectrometry: Assess cross-linker chemistry and accessibility

    • Proximity labeling (BioID, APEX): Evaluate labeling radius and temporal resolution

  • Data quality assessment:

    • Implement appropriate negative controls (e.g., non-interacting protein pairs)

    • Include positive controls of known interacting partners

    • Calculate false discovery rates based on reversed database searches

    • Apply confidence scoring systems for interaction reliability

  • Biological context evaluation:

    • Consider the cellular localization of potential interaction partners

    • Assess co-expression patterns during infection or stress conditions

    • Evaluate evolutionary conservation of interactions across bacterial species

    • Determine whether interactions are constitutive or condition-dependent

  • Validation strategy framework:

    Primary PPI MethodRecommended Validation ApproachControls to IncludeCommon Pitfalls
    Co-immunoprecipitationReverse IP and Western blottingIgG control, lysate inputDetergent effects on membrane protein interactions
    Bacterial two-hybridFRET or split-reporter assaysEmpty vector controlsMembrane topology issues
    Crosslinking-MSTargeted MS/MS validationNon-crosslinked samplesDistance constraint violations
    Proximity labelingFluorescence microscopy co-localizationBioID-only controlsNon-specific labeling
  • Integration with functional data:

    • Connect identified interactions with virulence phenotypes

    • Assess effects of qseC mutations on interaction networks

    • Evaluate how qseC inhibitors (e.g., LED209) affect interaction patterns

    • Develop hypotheses about signaling pathway architecture based on interaction data

  • Addressing common interpretation challenges:

    • Distinguish direct from indirect interactions

    • Consider effects of overexpression on non-physiological interactions

    • Evaluate potential for interactions that occur only during specific infection stages

    • Address challenges in detecting transient or weak interactions

By applying these analytical principles, researchers can generate more reliable interpretations of qseC protein-protein interaction data, leading to improved understanding of qseC signaling networks and their roles in Salmonella virulence regulation.

How can researchers effectively design experiments to study qseC in host-pathogen interactions?

Designing effective experiments to study qseC in host-pathogen interactions requires careful consideration of methodological approaches, controls, and analytical frameworks:

  • Infection model selection and validation:

    • Cell line considerations: Choose relevant cell types (macrophages, epithelial cells) based on infection stage being studied

    • Primary cell models: Consider using primary macrophages for more physiologically relevant responses

    • 3D culture systems: Implement organoid or tissue-chip models for complex host-pathogen interactions

    • In vivo models: Select appropriate animal models based on research questions and ethical considerations

  • Experimental design structure:

    • Implement hierarchical quasi-experimental designs with multiple measurements

    • Include appropriate controls: uninfected cells, cells infected with wild-type bacteria, qseC mutants, and complemented strains

    • Design time-course experiments to capture dynamic host-pathogen interactions

    • Use multiple MOIs (multiplicities of infection) to determine dose-dependent effects

  • Bacterial strain engineering considerations:

    • Create fluorescently labeled strains for live imaging experiments

    • Develop reporter strains to monitor qseC-dependent gene expression during infection

    • Generate clean deletion mutants with minimal polar effects

    • Engineer point mutations in key qseC domains to dissect functional mechanisms

  • Host response measurement:

    • Cytokine profiling: Measure IL-1β and other inflammatory mediators using ELISA or multiplex assays

    • Cell death assessment: Quantify LDH release, caspase-1 activation, and other pyroptosis markers

    • Transcriptomic analysis: Perform RNA-Seq on infected host cells to capture global response patterns

    • Microscopy approaches: Visualize host cell structural changes and bacterial localization

  • Comprehensive experimental design matrix:

    Experimental ObjectiveBacterial StrainsHost ModelsKey MeasurementsControls
    qseC role in invasionWT, ΔqseC, complementedEpithelial cellsInvasion efficiency, SPI-1 gene expressionHeat-killed bacteria
    qseC in intracellular survivalWT, ΔqseC, complementedMacrophagesBacterial counts, SCV integrityPhagocytosis inhibitors
    qseC inhibitor efficacyWT + inhibitor concentrationsMacrophagesVirulence gene expression, LDH releaseInactive analog, solvent
    Host inflammasome activationWT, ΔqseC, complementedPrimary macrophagesCaspase-1, IL-1β, cell deathNLRC4-/- macrophages
  • Data analysis recommendations:

    • Apply appropriate statistical methods based on data distribution and experimental design

    • Calculate effect sizes to determine biological significance

    • Consider using mixed-effects models for time-course experiments

    • Implement multivariate analysis to identify patterns across multiple parameters

By following this comprehensive experimental design framework, researchers can generate robust and reproducible data on qseC's role in host-pathogen interactions, leading to improved understanding of Salmonella pathogenesis and potential therapeutic interventions.

What are the most promising future directions in qseC research?

Based on current evidence and methodological advancements, several promising research directions for qseC are emerging:

  • Structure-guided inhibitor development:

    • Applying high-resolution structural biology techniques to elucidate the complete three-dimensional structure of qseC

    • Utilizing structure-based virtual screening to discover novel qseC inhibitors beyond LED209

    • Developing allosteric inhibitors targeting critical signaling interfaces

    • Creating targeted degradation approaches for bacterial histidine kinases

  • Systems biology of qseC signaling networks:

    • Mapping the complete qseC regulon across diverse infection conditions

    • Identifying intersection points between qseC and other virulence regulatory systems

    • Developing predictive models of qseC-mediated virulence regulation

    • Understanding temporal dynamics of qseC signaling during host infection

  • Translational applications:

    • Evaluating qseC inhibitors in preclinical infection models

    • Developing combination therapies targeting both conventional antimicrobial targets and virulence mechanisms

    • Creating diagnostic approaches based on qseC activity or expression

    • Engineering attenuated vaccine strains with modified qseC signaling

  • Host-pathogen interface studies:

    • Investigating how host signals are recognized by qseC

    • Understanding how qseC-dependent virulence factors modulate host immune responses

    • Studying population heterogeneity in qseC-regulated virulence expression

    • Examining qseC's role in Salmonella persistence and antibiotic tolerance

  • Methodological innovations:

    • Developing real-time biosensors to monitor qseC activity during infection

    • Creating high-throughput screening platforms for qseC-targeted compounds

    • Implementing CRISPR-based approaches to systematically dissect qseC signaling pathways

    • Applying single-cell technologies to understand heterogeneity in qseC-dependent responses

By pursuing these research directions with rigorous experimental design and appropriate methodological approaches, investigators can advance our understanding of qseC's role in bacterial pathogenesis and develop novel strategies to combat Salmonella infections.

What methodological recommendations can improve reproducibility in qseC research?

To enhance reproducibility in qseC research, the following methodological recommendations should be implemented:

  • Standardization of experimental protocols:

    • Create detailed standard operating procedures (SOPs) for key qseC-related assays

    • Standardize bacterial growth conditions and media composition

    • Establish consistent methods for protein expression and purification

    • Define uniform parameters for virulence phenotype measurements

  • Strain and reagent validation:

    • Verify bacterial strains by genome sequencing before experimental use

    • Authenticate cell lines used in infection models

    • Validate antibody specificity with appropriate controls

    • Characterize recombinant proteins by multiple methods (SDS-PAGE, mass spectrometry)

  • Robust experimental design principles:

    • Implement appropriate quasi-experimental study designs

    • Include multiple pretest measurements to establish baseline trends

    • Use nonequivalent dependent variables to strengthen causal inferences

    • Apply blinding procedures during data collection and analysis when possible

  • Comprehensive reporting standards:

    • Document complete methodological details including buffer compositions

    • Report protein storage conditions and handling procedures

    • Include detailed statistical analysis methods

    • Present all data including negative and inconclusive results

  • Reproducibility-enhancing practices:

    Research PhaseRecommended PracticeImplementation StrategyExpected Impact
    Study designSample size calculationPower analysis based on preliminary dataAdequately powered studies
    Data collectionRandomizationRandom allocation to experimental groupsReduced selection bias
    AnalysisPredefined analysis planDocument analysis plan before experimentPrevents p-hacking
    ReportingARRIVE guidelines for animal studiesComplete checklist for all animal experimentsComprehensive methods disclosure
    Data sharingOpen data repositoriesDeposit raw data in field-appropriate databasesEnables independent verification
  • Cross-laboratory validation:

    • Establish multi-laboratory consortium for critical qseC findings

    • Implement round-robin testing of key protocols

    • Create repository of validated qseC constructs and bacterial strains

    • Develop shared analytical pipelines for data processing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.