Recombinant Salmonella typhimurium sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

UgpA is a permease subunit of the UgpABCE ATP-binding cassette (ABC) transporter, which facilitates G3P uptake under phosphate-limiting conditions . Key features include:

  • Gene location: The ugpA gene is part of the ugp operon, positioned near aroB and malA on the Salmonella chromosome .

  • Structural role: UgpA forms a transmembrane channel, working with UgpB (substrate-binding protein) and UgpC/UgpE (ATPase components) to transport G3P .

  • Induction: Expression is upregulated during phosphate starvation via the PhoB/PhoR two-component system .

Role in G3P Transport and Pathogenesis

The Ugp system enables Salmonella to scavenge G3P as a phosphate source during infection . Key findings:

  • Transport kinetics: The Ugp-dependent system exhibits a lower affinity (Km=50 μMK_m = 50\ \mu M) compared to the GlpT transporter (Km=14 μMK_m = 14\ \mu M in E. coli), but both share similar VmaxV_{max} values (~2.2 nmol/min·10⁸ cells) .

  • Metabolic utility: G3P transported via Ugp is primarily used for phospholipid synthesis rather than carbon metabolism .

  • Pathogenicity link: Pho regulon activation, including UgpA, modifies lipid A structures to resist host antimicrobial peptides, aiding gut colonization .

Research Applications

Recombinant UgpA is utilized in:

  • Mechanistic studies: Elucidating ABC transporter architecture and substrate specificity .

  • Antimicrobial development: Targeting phosphate acquisition pathways to disrupt bacterial survival .

  • Vaccine design: Investigating outer membrane proteins as antigenic targets .

Comparative Analysis of G3P Transport Systems

The ugp and glpT systems in Salmonella exhibit distinct regulatory and functional profiles:

FeatureUgp SystemGlpT System
InductionPhosphate starvation Glycerol/G3P availability
Transport TypeBinding protein-dependent (ABC transporter) Facilitated diffusion
Substrate AffinityLower (Km=50 μMK_m = 50\ \mu M) Higher (Km=14 μMK_m = 14\ \mu M in E. coli)
Genetic LocusugpABCE operon glpTQ operon

Key Research Findings

  • Cloning and overexpression: The ugpA gene was successfully cloned into E. coli using a multicopy plasmid, resulting in a 33 kDa membrane protein .

  • Membrane protein interference: Overexpression of UgpA alters E. coli envelope protein synthesis, suppressing ribose-binding protein production .

  • Pho regulon synergy: UgpA works with PagP and UgtL to modify lipid A, enhancing resistance to α-helical antimicrobial peptides like magainin 2 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ugpA; STM3556; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
ugpA
Target Protein Sequence
MSSSRPVFRSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLENFV ALFHDSYYLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMLLPYAVAPA VAAVLWIFLFNPGRGLITHFLGEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFFAA LQSIPRSLVEAAAIDGAGPIRRFFRLSLPLIAPVSFFLLVVNLVYAFFDTFPVIDAATAG GPVQATTTLIYKIYREGFTGLDLSASAAQSVVLMFLVIILTVVQFRYVESKVRYQ
Uniprot No.

Target Background

Function
This protein is a component of the binding-protein-dependent transport system for sn-glycerol-3-phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: stm:STM3556

STRING: 99287.STM3556

Protein Families
Binding-protein-dependent transport system permease family, UgpAE subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ugpA protein and what is its role in Salmonella typhimurium?

The ugpA protein is a crucial component of the ugp-dependent transport system for sn-glycerol-3-phosphate in Salmonella typhimurium. This system functions as an alternative to the glpT-dependent transport mechanism. The ugp-dependent system, which includes ugpA, is notably derepressed under phosphate starvation conditions, indicating its role in phosphate acquisition during nutrient limitation . To study this protein effectively, researchers should consider comparative analyses between ugp and glpT systems, as they represent parallel pathways for sn-glycerol-3-phosphate transport with distinct regulatory mechanisms.

How does the ugp-dependent transport system compare to the glpT-dependent system in S. typhimurium?

S. typhimurium contains two distinct transport systems for sn-glycerol-3-phosphate: the glpT-dependent system and the ugp-dependent system. The glpT-dependent system is inducible by growth on glycerol and sn-glycerol-3-phosphate, exhibiting an apparent Km of 50 μM and a Vmax of 2.2 nmol/min per 10^8 cells in fully induced cells . In contrast, the ugp-dependent system, which includes ugpA, is specifically derepressed during phosphate starvation, suggesting evolutionary adaptation for nutrient acquisition under stress conditions . When designing experiments to study these systems, it is critical to control phosphate availability to differentiate between the two transport mechanisms.

What experimental approaches are recommended for studying ugpA expression patterns?

For studying ugpA expression patterns, a multifaceted approach is recommended:

  • Phosphate starvation assays: Culture S. typhimurium under varying phosphate concentrations to monitor ugpA expression levels. This approach allows for quantification of the derepression response under controlled conditions.

  • Reporter gene fusions: Construct ugpA-lacZ or ugpA-gfp fusions to visualize and quantify expression patterns under different environmental conditions.

  • Quantitative RT-PCR: Measure ugpA transcript levels in response to environmental stimuli, particularly phosphate availability.

  • Western blot analysis: Use antibodies specific to ugpA to detect protein levels across different growth conditions.

These methods should be performed with appropriate controls, including parallel analysis of glpT expression, to establish the distinct regulatory patterns of these transport systems .

How do mutations in the ugpA gene affect S. typhimurium virulence and survival during infection?

The relationship between ugpA mutations and S. typhimurium virulence involves complex host-pathogen interactions. During infection, S. typhimurium encounters phosphate-limited environments within host cells, particularly in macrophage phagosomes. Under these conditions, the ugp-dependent transport system becomes critical for bacterial survival and replication.

Research methodologies to investigate this relationship should include:

  • Construction of defined ugpA deletion mutants: Using homologous recombination or CRISPR-Cas9 techniques to create precise gene deletions.

  • In vivo infection models: Comparing wild-type and ugpA mutant strains in mouse models of infection, with analysis of bacterial burden in tissues, survival rates, and inflammatory responses.

  • Macrophage survival assays: Quantifying intracellular replication within primary macrophages or cell lines under defined phosphate conditions.

  • Complementation studies: Reintroducing functional ugpA to confirm phenotype restoration and rule out polar effects.

When interpreting results, researchers should consider the redundancy between transport systems and possible compensatory mechanisms that may mask virulence phenotypes in single-gene deletion studies .

What are the structural and functional relationships between ugpA and other components of the ugp transport system?

The ugp transport system in S. typhimurium, similar to its counterpart in E. coli, comprises multiple protein components that work cooperatively. Understanding the structural and functional relationships requires sophisticated analytical approaches:

  • Protein-protein interaction studies: Techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking studies can identify interactions between ugpA and other components.

  • Structural biology approaches: X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy to determine the three-dimensional structure of ugpA alone and in complex with other system components.

  • Site-directed mutagenesis: Systematic alteration of key residues to identify domains essential for protein-protein interactions, substrate binding, or transport function.

  • Membrane reconstitution assays: Purification and reconstitution of the complete transport system in liposomes to study transport kinetics and substrate specificity in a controlled environment.

These investigations should consider the parallels with E. coli systems, where the binding protein-dependent transport system for sn-glycerol-3-phosphate has been characterized as part of the pho regulon .

How does the regulation of ugpA expression integrate with broader phosphate-responsive networks in S. typhimurium?

The regulation of ugpA within the broader phosphate-responsive network presents a complex research challenge. Methodological approaches should include:

  • Global transcriptome analysis: RNA-seq comparing wild-type and regulatory mutants (e.g., phoB/phoR) under varying phosphate conditions to position ugpA within the broader regulon.

  • Chromatin immunoprecipitation (ChIP-seq): Identifying direct binding of regulatory proteins to the ugpA promoter region.

  • Promoter dissection studies: Creating a series of promoter deletions and point mutations to identify critical regulatory elements.

  • Phosphate-responsive protein interaction networks: Proteomics approaches to identify proteins that interact with ugpA or its regulators in a phosphate-dependent manner.

Analysis should focus on integration with the pho regulon and potential cross-regulation with other nutrient acquisition systems, considering that the ugp system in S. typhimurium, like in E. coli, appears to be part of the pho regulon, activated under phosphate limitation conditions .

What are the optimal conditions for expressing and purifying recombinant ugpA protein?

The expression and purification of recombinant ugpA protein requires careful optimization due to its nature as a membrane-associated protein. A systematic approach includes:

  • Expression system selection:

    • E. coli BL21(DE3) or derivatives: For basic expression

    • C41(DE3) or C43(DE3) strains: Specialized for membrane protein expression

    • S. typhimurium expression systems: For native protein folding

  • Vector design considerations:

    • Include affinity tags (His6, FLAG) for purification

    • Consider fusion partners (MBP, SUMO) to enhance solubility

    • Employ inducible promoters for controlled expression

  • Membrane protein extraction protocol:

    • Gentle cell lysis (e.g., French press or sonication)

    • Membrane fraction isolation via ultracentrifugation

    • Detergent screening for optimal solubilization (DDM, LDAO, etc.)

  • Purification strategy:

    • IMAC (immobilized metal affinity chromatography) for His-tagged constructs

    • Size exclusion chromatography for final polishing

    • Analysis of protein purity via SDS-PAGE and Western blotting

This methodology draws on approaches used for other membrane transport proteins in S. typhimurium, where similar techniques have been successfully applied .

What experimental approaches can differentiate between ugpA and glpT activities in S. typhimurium?

Differentiating between ugpA and glpT activities requires controlled experimental conditions that selectively activate or inhibit each system:

  • Growth condition manipulation:

    ConditionExpected Dominant SystemMethodology
    High phosphate + glycerolglpTLB medium supplemented with 2 mM phosphate and 0.2% glycerol
    Low phosphateugpMinimal medium with <0.1 mM phosphate
    Fosfomycin resistanceIndicates glpT mutationSelection on media containing fosfomycin
  • Genetic approach:

    • Construction of single (ΔglpT or ΔugpA) and double (ΔglpT ΔugpA) mutants

    • Complementation with plasmid-expressed genes

    • Transport assays using radiolabeled sn-glycerol-3-phosphate

  • Kinetic analysis:

    • Determine transport parameters (Km, Vmax) under different conditions

    • Compare with known values: glpT system Km ≈ 50 μM vs. E. coli system Km ≈ 14 μM

  • Inhibitor studies:

    • Use of fosfomycin as a specific inhibitor of glpT-mediated transport

    • Phosphate analogs as competitive inhibitors of the ugp system

This approach builds on established methodologies for characterizing transport systems in S. typhimurium, enabling clear differentiation between these parallel pathways .

How can researchers effectively clone and express the ugpA gene in heterologous systems?

Effective cloning and expression of the ugpA gene in heterologous systems requires consideration of several critical factors:

  • Gene amplification and cloning strategy:

    • PCR amplification using high-fidelity polymerase and S. typhimurium genomic DNA

    • Addition of appropriate restriction sites or Gibson Assembly overhangs

    • Verification of sequence integrity through DNA sequencing

  • Expression vector selection:

    • For E. coli expression: pET series (T7-based) or pBAD (arabinose-inducible)

    • For eukaryotic expression: appropriate shuttle vectors with selectable markers

    • Consideration of copy number and promoter strength

  • Codon optimization considerations:

    • Analysis of codon usage bias between S. typhimurium and the expression host

    • Optimization if necessary, particularly for rare codons

  • Expression optimization protocol:

    ParameterOptimization RangeMonitoring Method
    Temperature16-37°CSDS-PAGE, Western blot
    Inducer concentrationIPTG: 0.1-1 mM; Arabinose: 0.002-0.2%SDS-PAGE, Western blot
    Induction timingOD600: 0.4-1.0Growth curve, protein yield
    Expression duration3-24 hoursTime-course sampling
  • Functional verification:

    • Complementation of ugpA mutants

    • Transport assays using radioactive or fluorescently labeled substrates

    • Protein localization studies using immunofluorescence or GFP fusions

This approach draws on established molecular cloning techniques used for membrane proteins, with specific adaptations for the challenges of expressing transport proteins in heterologous systems. The methodology is similar to that used for cloning the glpT gene from S. typhimurium into E. coli, where functional expression was successfully achieved .

How should researchers interpret contradictory findings related to ugpA function across different experimental models?

When facing contradictory findings related to ugpA function, researchers should implement a systematic analytical approach:

  • Experimental context analysis:

    • Evaluate differences in strain backgrounds (laboratory vs. clinical isolates)

    • Compare growth conditions, particularly phosphate concentrations

    • Assess genetic backgrounds (wild-type vs. various mutant combinations)

  • Methodological comparison framework:

    AspectEvaluation PointsResolution Approach
    Genetic manipulationConstruction method, verification, polar effectsComplementation studies
    Phenotypic assaysSensitivity, specificity, controlsStandardized protocols, multiple assay types
    Expression systemsInduction levels, protein folding, localizationNative vs. recombinant expression comparison
  • Statistical re-evaluation:

    • Power analysis to determine if sample sizes were adequate

    • Consideration of biological vs. technical replicates

    • Application of appropriate statistical tests based on data distribution

  • Integration with broader literature:

    • Comparison with related transport systems, particularly in E. coli

    • Evaluation in light of established regulatory networks

What are the appropriate controls and statistical approaches for analyzing ugpA expression data?

Rigorous control implementation and statistical analysis are essential for reliable interpretation of ugpA expression data:

  • Essential experimental controls:

    • Positive control: Known phosphate-regulated gene (e.g., phoA)

    • Negative control: Constitutively expressed gene unaffected by phosphate levels

    • Strain controls: Wild-type vs. regulatory mutants (e.g., ΔphoB)

    • Media controls: Defined media with precise phosphate concentrations

  • Normalization approaches:

    • Use of multiple reference genes for qRT-PCR (gyrA, rpoD)

    • Normalization to total protein or cell number for protein expression

    • Inclusion of spike-in controls for RNA-seq experiments

  • Statistical methodology:

    Data TypeRecommended TestsAssumptions
    Continuous expression dataANOVA with post-hoc tests, t-testsNormal distribution, equal variance
    Non-normal dataKruskal-Wallis, Mann-Whitney UNon-parametric alternatives
    Time-course dataRepeated measures ANOVA, mixed effects modelsTime-dependence, autocorrelation
    Large-scale omicsFDR correction for multiple comparisonsControl for false discoveries
  • Visualization recommendations:

    • Expression data: Box plots showing distribution rather than bar graphs

    • Kinetic data: Michaelis-Menten plots with confidence intervals

    • Multiple conditions: Heat maps for pattern recognition

This approach ensures that expression differences attributed to experimental variables are statistically sound and biologically meaningful, similar to methodologies applied in studies of other components of phosphate transport systems .

How can CRISPR-Cas9 technology be applied to study ugpA function in S. typhimurium?

CRISPR-Cas9 technology offers powerful approaches for investigating ugpA function in S. typhimurium:

  • Precise genetic manipulation strategies:

    • Gene knockout: Complete deletion of ugpA with minimal polar effects

    • Point mutations: Introduction of specific amino acid changes to study structure-function relationships

    • Promoter modifications: Alterations to regulatory regions to study expression control

    • Epitope tagging: Addition of detection tags without disrupting function

  • Implementation methodology:

    StepCritical ConsiderationsTechnical Approach
    gRNA designSpecificity, efficiency, PAM availabilityBioinformatic tools for gRNA prediction
    Delivery systemTransformation efficiency in S. typhimuriumElectroporation of plasmid or RNP complexes
    Editing templateHomology arm length, selection markersPCR amplification or synthetic DNA
    ScreeningDetection of successful editsColony PCR, sequencing, phenotypic assays
  • Advanced applications:

    • CRISPRi for tunable gene repression without genetic modification

    • CRISPRa for enhanced expression in native context

    • Multiplexed editing to target multiple components of the ugp system simultaneously

  • Validation approaches:

    • Complementation with wild-type ugpA

    • Phenotypic characterization of transport function

    • Whole genome sequencing to confirm specificity

This methodology builds on genome editing approaches that have been successfully applied to study transport systems in related organisms, with specific adaptations for S. typhimurium's genetic characteristics and the membrane-associated nature of ugpA .

What proteomics approaches are most effective for studying ugpA protein interactions and complexes?

For studying ugpA protein interactions and complexes, several complementary proteomics approaches should be employed:

  • Affinity purification-mass spectrometry (AP-MS):

    • Expression of tagged ugpA (His, FLAG, or TAP tag)

    • Gentle solubilization with appropriate detergents

    • Affinity capture followed by mass spectrometry identification

    • SILAC or TMT labeling for quantitative comparison across conditions

  • Crosslinking mass spectrometry (XL-MS):

    • In vivo crosslinking: Capture of interactions in their native context

    • In vitro crosslinking: Controlled conditions with purified components

    • MS/MS analysis to identify crosslinked peptides

    • Molecular modeling to interpret spatial constraints

  • Protein correlation profiling:

    TechniqueApplicationKey Advantage
    Blue native PAGEIntact membrane complexesMaintains native state
    Size exclusion chromatographyComplex size determinationSeparation based on hydrodynamic radius
    Sucrose gradient centrifugationMembrane protein complexesGentle separation method
  • Proximity labeling approaches:

    • BioID or APEX2 fusion to ugpA

    • Identification of proximal proteins in the membrane environment

    • Temporal control to capture dynamic interactions

  • Validation strategies:

    • Co-immunoprecipitation of identified partners

    • Bacterial two-hybrid confirmation

    • Functional assays examining transport with partner mutations

These methods address the challenges of studying membrane protein interactions, similar to approaches used for characterizing other components of transport systems in bacteria .

How does post-translational modification affect ugpA function and regulation?

Investigation of post-translational modifications (PTMs) affecting ugpA function requires specialized analytical approaches:

  • Identification of potential modifications:

    • Phosphoproteomics: MS/MS analysis after phosphopeptide enrichment

    • Global PTM screening: Combined fractional diagonal chromatography (COFRADIC)

    • Site-specific analysis: Targeted MS approaches for suspected modification sites

  • Functional significance assessment:

    Modification TypeDetection MethodFunctional Assessment
    PhosphorylationPhos-tag gels, MS/MSPhosphomimetic mutations (S/T→D/E)
    AcetylationAnti-acetyl lysine antibodiesK→Q or K→R mutations
    Lipid modificationsClick chemistryMutation of modification sites
  • Regulatory context exploration:

    • Temporal dynamics during phosphate starvation response

    • Kinase/phosphatase identification through inhibitor studies or candidate approaches

    • Integration with other stress responses

  • Structural and functional consequences:

    • Transport kinetics of modified vs. unmodified protein

    • Membrane localization and stability effects

    • Protein-protein interaction changes

  • Evolutionary conservation analysis:

    • Comparison of modification sites across bacterial species

    • Correlation with functional domains or interaction surfaces

This systematic approach provides insight into how PTMs might regulate ugpA function in response to environmental conditions, particularly important given the protein's role in nutrient acquisition under stress conditions .

What are the most promising research directions for studying ugpA in S. typhimurium?

Based on current knowledge and technological developments, several promising research directions emerge for studying ugpA in S. typhimurium:

  • Systems biology integration:

    • Network analysis of ugpA within the broader phosphate starvation response

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Mathematical modeling of transport kinetics and regulatory networks

  • Host-pathogen interaction studies:

    • Role of ugpA in intracellular survival within different host cell types

    • Contribution to virulence in various infection models

    • Potential as a target for anti-virulence strategies

  • Structural biology advances:

    • Cryo-EM structure determination of the complete ugp transport complex

    • Conformational dynamics during transport cycle

    • Structure-guided design of inhibitors

  • Synthetic biology applications:

    • Engineering optimized phosphate transport systems

    • Development of biosensors based on ugp regulation

    • Creation of attenuated vaccine strains through ugp modification

These directions build upon the foundation of knowledge about phosphate transport systems in S. typhimurium, extending into new applications and deeper mechanistic understanding with implications for both basic science and translational research .

How does the study of ugpA contribute to our understanding of bacterial transport systems and pathogenesis?

The study of ugpA provides valuable insights into broader aspects of bacterial physiology and pathogenesis:

  • Evolutionary perspectives:

    • Comparative analysis between S. typhimurium and E. coli transport systems reveals functional conservation despite sequence divergence

    • Adaptation of transport systems to different ecological niches and host environments

    • Evolution of regulatory networks controlling nutrient acquisition

  • Transport mechanism paradigms:

    • The ugp system represents a model for ATP-binding cassette (ABC) transporters

    • Insights into how bacteria maintain nutrient homeostasis under varying conditions

    • Understanding of membrane protein complex assembly and function

  • Pathogenesis implications:

    AspectContributionResearch Application
    Intracellular survivalNutrient acquisition in vacuolar compartmentsIdentification of potential drug targets
    Host immune responseRecognition of bacterial surface structuresVaccine development
    Metabolic adaptationShifts in phosphate acquisition strategiesUnderstanding bacterial persistence
  • Translational potential:

    • Development of inhibitors targeting phosphate transport as antimicrobial strategy

    • Diagnostic applications based on expression patterns

    • Biotechnological applications in engineered bacteria

The detailed study of ugpA thus contributes not only to our understanding of S. typhimurium biology but also to broader concepts in bacterial physiology, evolution, and host-pathogen interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.