Recombinant Salmonella typhimurium Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
mdtI; STM1483; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
mdtI
Target Protein Sequence
MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links

KEGG: stm:STM1483

STRING: 99287.STM1483

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant MdtI typically produced in laboratory settings?

Recombinant MdtI is typically produced through heterologous expression in E. coli expression systems. The process involves:

  • Cloning the mdtI gene into an appropriate expression vector with an N-terminal His-tag for purification

  • Transforming the recombinant plasmid into competent E. coli cells

  • Inducing protein expression under controlled conditions

  • Lysing the cells and purifying the protein through affinity chromatography using the His-tag

  • Confirming protein identity through SDS-PAGE analysis (purity typically >90%)

  • Lyophilizing the purified protein for storage and later reconstitution

For optimal experimental conditions, the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added as a cryoprotectant for long-term storage at -20°C/-80°C .

What expression systems are suitable for MdtI production?

While E. coli is the most commonly used expression system for MdtI production , alternative expression systems can be considered depending on research requirements:

Expression SystemAdvantagesLimitationsRecommended for MdtI?
E. coliHigh yield, cost-effective, rapid growthMay lack post-translational modificationsYes, proven effective
Cell-free (IVTT)Allows direct membrane integration studiesLower yield than cellular systemsYes, especially for functional studies
Yeast systemsBetter for eukaryotic proteinsMore complex, slowerNot typically necessary
Mammalian cellsNative folding of complex proteinsExpensive, low yieldNot necessary for bacterial proteins

Cell-free protein synthesis systems (IVTT) have been particularly valuable for studying membrane integration properties of MdtI and its interaction with the Sec translocon machinery .

What methodologies are most effective for studying MdtI membrane integration?

For investigating MdtI membrane integration, in vitro transcription and translation (IVTT) systems encapsulated within cell-sized liposomes have proven highly effective. This methodology allows for the simultaneous study of protein synthesis and membrane integration under controlled conditions.

The recommended approach involves:

  • Reconstituting the Sec translocon (SRP/SR pathway and SecYEG complex) inside cell-sized liposomes

  • Encapsulating protein synthesis machinery (PURE system) within these liposomes

  • Adding the mdtI gene or mRNA for in situ protein synthesis

  • Monitoring membrane integration through fluorescence-based assays

  • Comparing integration efficiency with and without the Sec translocon

How does MdtI interact with the Sec translocon, and what are the implications for protein folding studies?

MdtI interaction with the Sec translocon represents a critical step in its proper membrane integration. Research findings indicate:

  • MdtI alone shows poor membrane integration in the absence of the Sec translocon

  • MdtI and MdtJ co-expression results in a 3.23-fold increase in membrane integration when the Sec translocon is present

  • This suggests the Sec translocon affects the topology of one or both proteins, facilitating proper heterodimer assembly and subsequent membrane integration

These findings have important implications for protein folding studies, suggesting that:

  • Membrane protein integration studies should incorporate the Sec translocon to achieve physiologically relevant results

  • Heterodimeric membrane proteins may require co-expression of partner proteins for proper folding and integration

  • The Sec translocon may play a regulatory role in determining the final topology of certain membrane proteins

For researchers studying membrane protein folding, incorporating the Sec translocon in experimental design is essential for obtaining results that accurately reflect in vivo conditions .

What experimental approaches can resolve the structure-function relationships of MdtI?

To elucidate the structure-function relationships of MdtI, researchers should consider a multi-faceted approach:

  • High-resolution structural studies:

    • X-ray crystallography of purified MdtI/MdtJ complexes

    • Cryo-electron microscopy to visualize the heterodimer in a membrane environment

    • NMR studies of isotopically labeled protein

  • Functional characterization:

    • Transport assays using reconstituted proteoliposomes with fluorescently labeled spermidine

    • Electrophysiological measurements to characterize transport kinetics

    • Substrate specificity determination using various polyamines

  • Mutagenesis approaches:

    • Alanine scanning of key residues to identify critical amino acids

    • Creation of chimeric proteins to map domain-specific functions

    • Site-directed mutagenesis targeting conserved motifs

The cell-sized liposome system with reconstituted Sec translocon provides an excellent platform for these studies, allowing for controlled expression and direct observation of functional integration .

What are the optimal conditions for reconstituting recombinant MdtI for functional studies?

For optimal reconstitution of recombinant MdtI in functional studies, researchers should follow these methodological guidelines:

  • Purified protein handling:

    • Briefly centrifuge the vial containing lyophilized MdtI before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended: 50%)

    • Aliquot for long-term storage at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles, as this compromises protein integrity

  • Proteoliposome preparation:

    • Use a lipid composition that mimics bacterial membranes

    • Ensure proper protein-to-lipid ratios (typically 1:100 to 1:1000 by weight)

    • Employ gentle detergent removal methods (dialysis, Bio-Beads, or gel filtration)

    • Verify successful reconstitution through density gradient centrifugation

  • Functional verification:

    • Employ transport assays with fluorescently labeled substrates

    • Monitor protein orientation in the membrane using protease protection assays

    • Validate activity through comparison with native membrane preparations

How can researchers investigate the MdtI-MdtJ heterodimer formation and its functional implications?

Investigating MdtI-MdtJ heterodimer formation requires specialized approaches that address both structural and functional aspects:

  • Co-expression strategies:

    • Design bicistronic constructs that express both MdtI and MdtJ from a single mRNA

    • Use dual-plasmid systems with compatible origins of replication

    • Employ differentially tagged versions (His-MdtI and FLAG-MdtJ) for co-purification studies

  • Interaction verification methods:

    • Chemical cross-linking followed by mass spectrometry

    • Förster resonance energy transfer (FRET) between fluorescently labeled proteins

    • Co-immunoprecipitation using antibodies against one component

    • Bimolecular fluorescence complementation (BiFC)

  • Functional comparison:

    • Transport activity of MdtI alone vs. MdtI-MdtJ heterodimer

    • Membrane integration efficiency with and without the Sec translocon

    • Substrate specificity alterations in the heterodimeric state

Research has demonstrated that the MdtI-MdtJ heterodimer shows significantly enhanced membrane integration (3.23-fold increase) compared to either protein alone when the Sec translocon is present, suggesting a cooperative mechanism for membrane insertion that depends on proper heterodimer formation .

What are the challenges and solutions for expressing membrane proteins like MdtI in recombinant systems?

Expressing membrane proteins like MdtI presents several challenges that require specific solutions:

ChallengeCauseSolution
Protein misfoldingHydrophobic regions prone to aggregationUse specialized E. coli strains (C41/C43); add solubilizing agents
CytotoxicityOverexpression disrupting host membranesUse tightly regulated inducible promoters; lower induction temperature
Low yieldInefficient translation of membrane proteinsOptimize codon usage; use specialized ribosomes
Improper membrane integrationAbsence of native membrane componentsCo-express with partner proteins (e.g., MdtJ); include Sec translocon
Purification difficultiesDetergent-mediated extraction issuesScreen multiple detergents; use mild extraction conditions

Cell-free expression systems offer a promising alternative, as they allow for the direct incorporation of membrane proteins into artificial lipid bilayers during synthesis, bypassing many of the challenges associated with cellular expression systems. Specifically, the PURE system encapsulated in liposomes with reconstituted Sec translocon has demonstrated successful production of functional MdtI, particularly when co-expressed with MdtJ .

How does MdtI from Salmonella typhimurium compare to homologous proteins in other bacterial species?

MdtI belongs to the small multidrug resistance (SMR) family of transporters found across numerous bacterial species. Comparative analysis reveals important similarities and differences:

  • Sequence conservation:

    • High sequence homology with E. coli MdtI (>90% identity)

    • Conserved transmembrane domains across Enterobacteriaceae

    • Variable regions primarily in loop structures

  • Functional comparison:

    • Most homologs function as heterodimers (MdtI/MdtJ-like)

    • Some related SMR proteins function as homodimers (EmrE-like)

    • Substrate specificity varies among homologs, with some primarily exporting polyamines and others handling diverse compounds

  • Evolutionary significance:

    • Core structure and mechanism conserved across diverse bacterial species

    • Specialized functions have evolved in different lineages

    • Potential horizontal gene transfer events suggested by phylogenetic analyses

Understanding these comparative aspects helps in extrapolating findings from MdtI studies to broader bacterial physiology and potential antimicrobial development strategies.

What role does the Sec translocon play in MdtI membrane integration and what are the implications for studying other membrane proteins?

The Sec translocon plays a crucial role in MdtI membrane integration, with significant implications for membrane protein research:

  • MdtI-specific effects:

    • MdtI alone shows minimal membrane integration without the Sec translocon

    • MdtI/MdtJ heterodimer integration increases 3.23-fold with the Sec translocon

    • The translocon likely affects the topology of one or both proteins, facilitating proper heterodimer assembly

  • General mechanisms:

    • The Sec translocon (SRP/SR pathway and SecYEG complex) facilitates co-translational insertion of membrane proteins

    • It helps establish correct topology by guiding transmembrane segments into the lipid bilayer

    • Proper folding and assembly of multi-subunit complexes are enhanced

  • Research implications:

    • In vitro studies of membrane proteins should include the Sec translocon for physiologically relevant results

    • Cell-sized liposomes with reconstituted Sec translocon provide an excellent platform for studying membrane protein integration

    • This system expands the repertoire of membrane proteins amenable to in vitro studies

The finding that membrane integration of 6 out of 9 E. coli integral membrane proteins was increased in the presence of the Sec translocon highlights the broad applicability of this approach .

How can advanced recombinant DNA technologies be leveraged to enhance MdtI research?

Modern recombinant DNA technologies offer numerous opportunities to advance MdtI research:

  • CRISPR-Cas9 applications:

    • Generate precise genetic modifications in native Salmonella strains

    • Create conditional knockouts to study physiological roles

    • Introduce reporter fusions at endogenous loci for live-cell imaging

  • Advanced expression systems:

    • Cell-free systems with reconstituted Sec translocon for functional studies

    • Specialized expression vectors with tunable promoters for titrated expression

    • Fusion partners that enhance stability while maintaining function

  • Structural biology approaches:

    • Nanobody-facilitated crystallization of membrane proteins

    • Novel detergent and lipid nanodisc systems for maintaining native structure

    • In-cell NMR for studying protein dynamics in near-native environments

  • High-throughput methodologies:

    • Directed evolution using FACS-based selection in liposomes

    • Deep mutational scanning to comprehensively map structure-function relationships

    • Synthetic biology approaches to engineer novel functions

These advanced technologies, particularly the combination of recombinant protein expression with reconstituted Sec translocon in cell-sized liposomes, provide powerful tools for elucidating the structure, function, and physiological role of MdtI and related membrane proteins .

What are the potential applications of MdtI research in developing new antimicrobial strategies?

Research on MdtI has significant implications for antimicrobial development through several potential mechanisms:

  • Target-based drug design:

    • MdtI/MdtJ inhibitors could disrupt polyamine homeostasis in bacterial cells

    • Structure-based virtual screening using the MdtI/MdtJ complex structure

    • Rational design of compounds that interfere with heterodimer formation

  • Membrane permeabilization strategies:

    • Understanding MdtI membrane integration could reveal vulnerabilities in bacterial membrane assembly

    • Compounds that interfere with Sec translocon-mediated insertion of multiple membrane proteins

    • Peptides designed to disrupt specific membrane protein-lipid interactions

  • Bacterial physiology insights:

    • Targeting polyamine transport systems to sensitize bacteria to existing antibiotics

    • Exploiting species-specific differences in MdtI homologs for selective targeting

    • Developing adjuvants that increase antibiotic accumulation by inhibiting efflux systems

The detailed understanding of MdtI structure, function, and membrane integration provided by recombinant protein studies lays essential groundwork for these antimicrobial strategies.

How might systems biology approaches integrate MdtI research into broader cellular networks?

Systems biology approaches can contextualize MdtI function within broader cellular networks:

  • Network analysis:

    • Mapping interactions between MdtI/MdtJ and other membrane and cytosolic proteins

    • Identifying regulatory networks controlling mdtI/mdtJ expression

    • Characterizing the role of MdtI in global polyamine homeostasis

  • Multi-omics integration:

    • Correlating transcriptomic changes in mdtI/mdtJ expression with metabolomic profiles

    • Proteomic analysis of membrane protein complexes under various stress conditions

    • Lipidomic studies to identify specific lipid interactions affecting MdtI function

  • Mathematical modeling:

    • Developing quantitative models of polyamine transport kinetics

    • Simulating the effects of MdtI inhibition on cellular physiology

    • Predicting emergent properties of polyamine transport systems

The cell-sized liposome system with reconstituted Sec translocon provides an excellent reductionist platform that can be progressively expanded to incorporate additional components, bridging the gap between isolated protein studies and whole-cell systems biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.