Recombinant Salmonella typhimurium Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Nomenclature and Classification

The protein under discussion has undergone significant nomenclature changes as its biological function has been elucidated. Initially annotated as YedZ in genomic sequences, it has since been reclassified as MsrQ based on its functional role in the methionine sulfoxide reductase system . In Salmonella typhimurium, this protein is encoded by the gene msrQ (also designated as STM3378) and has several alternative designations including "Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ" and "Flavocytochrome MsrQ" .

The transition from YedZ to MsrQ nomenclature reflects the scientific community's improved understanding of the protein's biological function within bacterial systems. While YedZ was merely a placeholder name during initial genome annotation projects, MsrQ more accurately describes its role as a component of the MsrPQ system involved in redox reactions .

Evolutionary Classification and Relationships

YedZ/MsrQ has been characterized through bioinformatics as a member of the FRD (Fumarate Reductase) superfamily of heme-containing membrane proteins, which includes the NADPH oxidase proteins (NOX/DUOX) . This classification establishes important evolutionary relationships between bacterial redox systems and more complex eukaryotic oxidative proteins involved in immunity and cellular signaling.

Research indicates that the MsrPQ system, of which YedZ/MsrQ is an integral component, appears to be specifically involved in the repair of periplasmic proteins that have been oxidized by hypochlorous acid . This specialized function suggests evolutionary adaptation to specific environmental stresses, particularly those encountered by pathogenic bacteria during host-pathogen interactions.

Heme-binding Characteristics

A defining feature of YedZ/MsrQ is its capacity to bind b-type heme cofactors, which are essential for its electron transfer functions. Detailed biochemical characterization combining UV-visible spectroscopy, heme quantification, and site-directed mutagenesis has demonstrated that YedZ/MsrQ can bind two b-type hemes through histidine residues that are conserved between the MsrQ and NOX protein families .

Studies on the E. coli homolog, which shares significant structural similarity with the Salmonella typhimurium protein, have identified specific histidine residues involved in heme coordination. Mutations of histidines 91, 151, and 164 significantly impact the heme content of the protein . The experimental data suggests that one heme-binding site involves His-164 and most likely His-91, similar to what has been reported for NOX enzymes . Interestingly, His-91 appears to play an additional role in the global stabilization of the second b-type heme cofactor. His-151 is involved in the coordination of the second heme, though with an atypical coordination pattern since the expected second canonical heme binding histidine is absent in the third transmembrane helix .

The MsrPQ Redox System

YedZ/MsrQ functions as a critical component of the MsrPQ system, a newly identified methionine sulfoxide reductase complex found in bacteria. This system is specifically involved in the repair of periplasmic proteins that have been oxidized by hypochlorous acid, a potent antimicrobial oxidant produced by host immune cells during infection .

The MsrPQ system consists of two proteins working in concert:

  1. MsrP (previously named YedY) - A periplasmic protein that carries out the methionine sulfoxide reductase activity

  2. MsrQ (previously named YedZ) - An integral b-type heme membrane-spanning protein that acts as the specific electron donor to MsrP

For the system to function effectively in vivo, MsrP must be specifically associated with MsrQ, highlighting the importance of their interaction for the repair of oxidized proteins in the bacterial periplasm .

Relationship to NADPH Oxidase Family

One of the most significant discoveries regarding YedZ/MsrQ is its relationship to the eukaryotic NADPH oxidase (NOX) family of proteins. Research has identified the MsrPQ system as "the first prokaryotic two-component protein system related to the eukaryotic NOX family" . This evolutionary relationship is based on structural and functional similarities, particularly in the arrangement of transmembrane domains and heme-binding sites.

The connection between bacterial YedZ/MsrQ and eukaryotic NOX proteins provides valuable insights into the evolution of complex redox systems across different domains of life and suggests potential conserved mechanisms for electron transfer and oxidoreductase activity that span prokaryotes and eukaryotes.

Electron Transport Mechanisms

YedZ/MsrQ participates in sophisticated electron transfer processes critical for the function of the MsrPQ system. Research has identified the E. coli flavin reductase Fre, which is related to the dehydrogenase domain of eukaryotic NOX enzymes, as an efficient cytosolic electron donor to the MsrQ heme moieties .

Cross-linking experiments and surface plasmon resonance studies have demonstrated that Fre interacts with MsrQ to form a specific complex . This interaction establishes an electron transfer pathway from cytosolic donors through MsrQ's heme centers and ultimately to MsrP, enabling the reduction of oxidized periplasmic proteins. This electron transport chain represents a sophisticated mechanism by which bacteria can repair oxidative damage to their periplasmic proteins.

Expression Systems and Purification

Recombinant production of Salmonella typhimurium YedZ/MsrQ has been successfully achieved using E. coli expression systems. The recombinant protein is typically fused to tags such as an N-terminal His-tag to facilitate purification and characterization . Commercially available recombinant Salmonella typhimurium YedZ/MsrQ is expressed in E. coli and purified to greater than 90% purity as determined by SDS-PAGE analysis .

Research on homologous proteins has optimized conditions for the overexpression and membrane solubilization of MsrQ, developing purification schemes that allow the production of pure protein suitable for detailed biochemical characterization . These approaches are likely applicable to the Salmonella typhimurium homolog as well, given the structural and functional similarities between these proteins across bacterial species.

Research Tools and Applications

Recombinant Salmonella typhimurium YedZ/MsrQ serves as a valuable research tool for multiple applications:

  1. Structural studies of bacterial membrane proteins

  2. Investigation of heme-protein interactions

  3. Analysis of electron transfer mechanisms

  4. Comparative studies of bacterial and eukaryotic redox systems

  5. Development of in vitro assays for oxidoreductase activity

The commercial availability of highly purified recombinant YedZ/MsrQ facilitates these research applications, with products available from suppliers such as MyBioSource.com and Creative Biomart at prices around $1,485.00 as of early 2025 .

Potential as Antimicrobial Targets

The specific role of YedZ/MsrQ in protecting bacteria against oxidative stress, particularly from host-derived oxidants like hypochlorous acid, suggests its potential as a target for novel antimicrobial strategies. Inhibiting the MsrPQ system could potentially enhance the effectiveness of host oxidative defenses against pathogens like Salmonella typhimurium, which cause significant disease burden worldwide.

Research into the structure-function relationships of YedZ/MsrQ may contribute to the development of small-molecule inhibitors that could disrupt this protective system, potentially offering new approaches to combat drug-resistant bacterial infections.

Table 3. Comparison of YedZ/MsrQ with Related Protein Systems

FeatureYedZ/MsrQ (Bacterial)NOX Family (Eukaryotic)Functional SignificanceReference
Heme BindingTwo b-type hemesMultiple hemesElectron transfer capacity
Electron SourceFlavin reductase (Fre)NADPHProvision of reducing equivalents
System ComponentsTwo proteins (MsrP + MsrQ)Single multi-domain proteinOrganizational differences in redox systems
Primary FunctionRepair of oxidized periplasmic proteinsSuperoxide production for immunityEvolutionary adaptation to environmental niches
Membrane IntegrationBacterial inner membranePlasma membranePositioning for appropriate redox partners

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
msrQ; STM3378; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
msrQ
Target Protein Sequence
MRLTAKQITWLKVCLHLAGFLPLLWLFWAINHGGLSADPVKDIQHFTGRTALKFLLATLL VSPLARYAKQPLLIRTRRLLGLWCFVWATLHLTSYALLELGIHNLALLGSELISRPYLTL GIISWLVLLALTLTSTQFAQRKLGKRWQTLHNVVYLVAILAPIHYLWSVKILSPQPVIYA ALALALLALRYRKFRQWWR
Uniprot No.

Target Background

Function
YedZ is a component of the MsrPQ system, which repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) by utilizing respiratory chain electrons. This protects proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated by host defense mechanisms. MsrPQ is crucial for maintaining envelope integrity under bleach stress, rescuing various periplasmic proteins from methionine oxidation. These include the primary periplasmic chaperone SurA and the lipoprotein Pal. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, using the quinone pool of the respiratory chain.
Database Links

KEGG: stm:STM3378

STRING: 99287.STM3378

Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YedZ and what is its function in Salmonella typhimurium?

YedZ, also known as MsrQ, is a 199-amino acid membrane-bound heme-binding subunit of the sulfoxide reductase system in Salmonella typhimurium. This protein is an integral component of bacterial defense mechanisms against oxidative stress. YedZ functions as part of the methionine sulfoxide reductase system that repairs oxidized methionine residues in proteins, which is crucial for maintaining protein function under oxidative stress conditions .

The protein contains a heme cofactor that participates in electron transfer reactions during the reduction of oxidized methionine residues. This redox function is essential for bacterial survival, particularly when facing oxidative bursts within phagocytes during host infection. The methionine repair system that includes YedZ helps prevent the loss of protein function that would otherwise result from methionine oxidation, ultimately preventing cell death under oxidative stress .

How does YedZ relate to other components of the methionine sulfoxide reductase system?

YedZ (MsrQ) operates as part of an integrated redox system consisting of several key components:

  • Methionine sulfoxide reductase A (MsrA) - The catalytic enzyme that reduces methionine-S-sulfoxide

  • YedZ/MsrQ - The heme-binding subunit facilitating electron transfer

  • Thioredoxin system - Including thioredoxins (TrxA and TrxC) and thioredoxin reductase (TrxB)

This system functions in a coordinated manner where MsrA catalyzes the reduction of methionine sulfoxide (Met-SO) back to methionine with electrons provided through the thioredoxin system . Experimental evidence shows that MsrA preferentially utilizes TrxA over TrxC, with NADPH-linked reductase assays demonstrating that MsrA consumed twice as much NADPH when TrxA was included compared to TrxC .

The thioredoxin system of Salmonella Typhimurium consists of two thioredoxins (TrxA and TrxC) and one thioredoxin reductase (TrxB), with TrxA being the preferred electron donor for MsrA-mediated repair reactions . YedZ likely serves as a crucial intermediate in this electron transfer pathway, with its heme group facilitating efficient electron movement within the system.

What expression systems yield optimal results for recombinant YedZ production?

The most effective expression system documented for recombinant YedZ is Escherichia coli. According to research data, recombinant full-length Salmonella typhimurium YedZ has been successfully expressed in E. coli with an N-terminal His-tag . This expression system offers several advantages:

  • Genetic similarity between E. coli and Salmonella typhimurium

  • High expression levels of recombinant proteins

  • Well-established protocols for induction and harvest

  • Compatibility with various purification strategies

For optimal expression, researchers should consider the following experimental parameters:

ParameterRecommended ConditionNotes
E. coli strainBL21(DE3) or derivativesStrains lacking lon and ompT proteases
Expression vectorpET or similar with T7 promoterProvides tight regulation and high expression
Induction0.5-1.0 mM IPTGLower temperatures (16-25°C) may improve folding
Growth mediaLB or 2xYT with appropriate antibioticsRicher media can increase yield
Induction time4-16 hoursDepends on temperature and strain

What purification strategies achieve highest purity of recombinant YedZ?

Based on available research data, the following purification strategy has been demonstrated to yield recombinant YedZ with greater than 90% purity as determined by SDS-PAGE :

  • Initial Capture: Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA or similar resins to capture the His-tagged YedZ protein

  • Intermediate Purification: Size exclusion chromatography to remove aggregates and separate monomeric protein

  • Polishing: Optional ion exchange chromatography step for highest purity requirements

The purification process can be optimized using the following parameters:

Purification StepBuffer CompositionCritical Parameters
Cell LysisTris/PBS-based buffer, pH 8.0 with protease inhibitorsGentle lysis to preserve protein structure
IMAC Binding20-50 mM imidazole in lysis bufferHigher imidazole reduces non-specific binding
IMAC Elution250-500 mM imidazole in lysis bufferStep or gradient elution
Size ExclusionTris/PBS-based buffer, pH 8.0Flow rate optimization for resolution

For membrane proteins like YedZ, addition of mild detergents during purification may be necessary to maintain solubility while preserving native structure and heme binding.

How can stability of purified recombinant YedZ be maintained?

Maintaining stability of purified recombinant YedZ requires careful consideration of storage conditions. According to product specifications, the following protocol is recommended :

  • Initial Form: The protein is typically provided as a lyophilized powder

  • Reconstitution: Dissolve in deionized sterile water to 0.1-1.0 mg/mL

  • Storage Buffer: Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • Cryoprotectant: Add glycerol to 5-50% final concentration (50% recommended)

  • Storage Temperature: Store at -20°C/-80°C upon receipt

  • Aliquoting: Create small working aliquots to avoid repeated freeze-thaw cycles

  • Short-term Storage: Working aliquots can be maintained at 4°C for up to one week

The addition of trehalose (6%) in the storage buffer is particularly noteworthy as this disaccharide acts as a stabilizing agent that protects protein structure during freezing and lyophilization .

What assays can reliably measure YedZ activity?

YedZ activity can be assessed through several complementary approaches focusing on its role in the methionine sulfoxide reductase system:

  • NADPH-linked Reductase Assays: The most direct method involves monitoring NADPH consumption spectrophotometrically at 340 nm. Research shows that when functioning with MsrA and thioredoxin, this system utilizes NADPH for the reduction of substrates such as S-methyl p-tolyl sulfoxide .

  • Substrate-specific Reduction Assays: The reduction of model substrates like S-methyl p-tolyl sulfoxide can be quantified to determine activity rates.

  • Coupled Enzyme Assays: A complete assay system would include:

    • Recombinant YedZ

    • MsrA (methionine sulfoxide reductase A)

    • Thioredoxin (preferably TrxA)

    • Thioredoxin reductase (TrxB)

    • NADPH as electron donor

    • Suitable methionine sulfoxide substrate

Based on experimental data, the following parameters have been established for MsrA activity in conjunction with the thioredoxin system, which would involve YedZ:

ComponentOptimal ConcentrationNotes
MsrA0.5-2 μMPurified recombinant protein
YedZ1-5 μMPurified recombinant protein
TrxA5-10 μMPreferential over TrxC by 2-fold
TrxB0.5-1 μMThioredoxin reductase
NADPH100-200 μMMonitor consumption at 340 nm
Substrate1-5 mMS-methyl p-tolyl sulfoxide or similar

What techniques effectively characterize protein-protein interactions involving YedZ?

Understanding the interactions between YedZ and other components of the methionine sulfoxide reductase system requires specialized techniques:

  • Co-immunoprecipitation (Co-IP): Using antibodies against YedZ or interaction partners to pull down protein complexes

  • Pull-down Assays: Leveraging the His-tag on recombinant YedZ to identify binding partners

  • Surface Plasmon Resonance (SPR): For detailed kinetic analysis of protein interactions

  • Isothermal Titration Calorimetry (ITC): Provides thermodynamic parameters of binding interactions

  • Blue Native PAGE: Useful for analyzing membrane protein complexes in their native state

Research has demonstrated that MsrA interacts with the thioredoxin system, showing a preference for TrxA over TrxC in functional assays . The interaction between YedZ and MsrA is crucial for the electron transfer process during methionine sulfoxide reduction, and characterizing this interaction provides insights into the mechanism of action of this system.

How can researchers analyze the heme-binding properties of YedZ?

As a heme-binding protein, YedZ's interaction with heme is central to its function. Several specialized techniques can characterize this interaction:

  • UV-visible Spectroscopy: Heme proteins exhibit characteristic absorption spectra that change upon binding, oxidation state alterations, or ligand binding

  • Resonance Raman Spectroscopy: Provides detailed information about the heme environment and coordination state

  • Electron Paramagnetic Resonance (EPR): Essential for studying the oxidation and spin states of the heme iron

  • Heme Incorporation Assays: Can determine the efficiency of heme binding to recombinant YedZ

  • Site-directed Mutagenesis: To identify key residues involved in heme coordination

Typical spectroscopic features of heme proteins include:

Spectral FeatureTypical WavelengthSignificance
Soret Band400-430 nmIndicates heme incorporation
α-band550-570 nmSensitive to oxidation state
β-band520-540 nmSecondary heme absorption band
Charge Transfer Bands>600 nmIndicates high-spin ferric heme

How does YedZ contribute to Salmonella typhimurium virulence?

YedZ plays a significant role in Salmonella virulence through its function in the methionine sulfoxide reductase system. This contribution operates through several mechanisms:

  • Oxidative Stress Protection: YedZ helps Salmonella typhimurium survive oxidative burst within phagocytes by facilitating the repair of oxidized proteins .

  • Intracellular Survival: Research has established that "Intraphagocytic survival of Salmonella Typhimurium depends (at least in part) upon its ability to repair oxidant-damaged macromolecules" . As a component of this repair system, YedZ contributes directly to bacterial persistence within host cells.

  • Protein Function Maintenance: By participating in the reduction of methionine sulfoxide back to methionine, YedZ helps maintain the function of proteins essential for bacterial virulence and survival.

  • Immune Response Modulation: Recombinant Salmonella strains can elicit specific immune responses, with heterologous antigens generating different IgG subclass profiles than Salmonella's own antigens . The oxidation state of bacterial proteins, influenced by the YedZ system, may affect how they are recognized by the host immune system.

What is the role of YedZ in countering oxidative stress?

YedZ functions as a critical component in Salmonella's defense against oxidative stress:

  • Methionine Repair System: Oxidation of methionine residues leads to Met-SO formation and consequently loss of protein function that can result in cell death . YedZ, as part of the methionine sulfoxide reductase system, helps reverse this damage.

  • Electron Transfer: The heme group in YedZ likely facilitates electron transfer during the reduction of methionine sulfoxide back to methionine.

  • Thioredoxin System Integration: YedZ works in concert with thioredoxins (particularly TrxA) and thioredoxin reductase to form a complete electron transfer pathway for methionine sulfoxide reduction .

  • Protection Against Phagocyte-generated Oxidants: Research has shown that "Met residues either free or in protein bound form are highly susceptible to phagocyte-generated oxidants" . YedZ's role in repairing this damage is therefore particularly important during host-pathogen interactions.

Experimental evidence from gene deletion studies supports the importance of this system, as methionine sulfoxide reductase A (msrA) gene deletion strains of Salmonella typhimurium showed increased susceptibility to oxidative stress .

What experimental approaches can assess YedZ's contribution to bacterial survival in host environments?

Several methodological approaches can evaluate the role of YedZ in bacterial survival:

  • Gene Deletion Studies: Creating ΔyedZ mutants and assessing their survival under various stress conditions, particularly within phagocytes.

  • Complementation Experiments: Reintroducing yedZ on an expression plasmid to confirm phenotype restoration in deletion mutants.

  • In vitro Oxidative Stress Models: Exposing wild-type and ΔyedZ strains to hydrogen peroxide, superoxide generators, or other oxidants.

  • Cell Infection Models: Using macrophage cell lines to assess intracellular survival of Salmonella strains with or without functional YedZ.

  • Animal Infection Models: Comparing virulence and tissue burden of wild-type versus ΔyedZ Salmonella strains in appropriate animal models.

  • Recombinant Expression System Analysis: Studying recombinant Salmonella strains expressing modified forms of YedZ to understand structure-function relationships .

Prior research has utilized BALB/c mice for in vivo assessment of Salmonella strains expressing recombinant proteins, demonstrating that such systems can generate robust immune responses to both heterologous antigens and Salmonella antigens .

How can researchers develop inhibitors targeting YedZ for antimicrobial applications?

Targeting YedZ for antimicrobial development represents a promising strategy based on its role in bacterial survival under oxidative stress. Researchers can pursue several approaches:

  • High-throughput Screening: Developing assays to screen compound libraries for inhibitors of YedZ function, focusing on:

    • Disruption of heme binding

    • Interference with YedZ-MsrA interactions

    • Inhibition of electron transfer capability

  • Structure-based Drug Design: Using structural information about YedZ to design molecules that can:

    • Compete with heme for binding

    • Bind to interaction surfaces between YedZ and partner proteins

    • Induce conformational changes that inhibit function

  • Mechanism-based Inhibitors: Designing compounds that react with the heme cofactor or critical amino acid residues upon electron transfer, permanently inactivating the protein.

  • Peptide-based Inhibitors: Developing peptides that mimic interaction surfaces of YedZ's partner proteins, thereby disrupting the formation of functional complexes.

  • Combination Approaches: Testing YedZ inhibitors in combination with conventional antibiotics or oxidative stress-inducing compounds for synergistic effects.

What experimental approaches should be used to study YedZ across different bacterial species?

A comprehensive comparative analysis of YedZ across different bacterial pathogens would involve:

  • Phylogenetic Analysis: Constructing phylogenetic trees based on YedZ sequences to understand evolutionary relationships and conservation.

  • Structural Comparison: Using computational modeling and structural biology techniques to compare:

    • Heme-binding pockets

    • Protein-protein interaction surfaces

    • Membrane topology

  • Functional Complementation: Testing whether YedZ from different species can complement each other's function in knockout strains.

  • Species-specific Adaptations: Identifying unique features of YedZ in different bacterial species that might reflect adaptation to specific host environments or ecological niches.

  • Heterologous Expression: Expressing YedZ from different bacterial species in a common background strain to compare functional properties under identical conditions.

This comparative approach could reveal conserved regions essential for function across species, as well as species-specific adaptations that might be relevant for pathogenesis or antimicrobial development.

What emerging technologies could advance our understanding of YedZ function?

Several cutting-edge technologies hold promise for deeper insights into YedZ biology:

  • Cryo-electron Microscopy: For high-resolution structural studies of YedZ alone or in complex with partner proteins.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map protein dynamics and interaction surfaces under different conditions.

  • Single-molecule FRET: To study conformational changes and protein-protein interactions in real-time.

  • Chemical Cross-linking Coupled with Mass Spectrometry: To identify interaction partners and map interaction surfaces.

  • CRISPR-Cas9 Genome Editing: For precise modification of YedZ in its native genomic context to study structure-function relationships.

  • Protein Engineering: Creating chimeric proteins or introducing unnatural amino acids to probe specific aspects of YedZ function.

  • In vivo Imaging: Using fluorescently tagged YedZ to track its localization and dynamics during infection processes.

These advanced techniques, when combined with more traditional biochemical and microbiological approaches, can provide a comprehensive understanding of YedZ function in bacterial physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.