Recombinant Salmonella typhimurium Surface presentation of antigens protein spaS (spaS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please specify them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
spaS; STM2887; Surface presentation of antigens protein SpaS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
spaS
Target Protein Sequence
MSSNKTEKPTKKRLEDSAKKGQSFKSKDLIIACLTLGGIAYLVSYGSFNEFMGIIKIIIA DNFDQSMADYSLAVFGIGLKYLIPFMLLCLVCSALPALLQAGFVLATEALKPNLSALNPV EGAKKLFSMRTVKDTVKTLLYLSSFVVAAIICWKKYKVEIFSQLNGNIVGIAVIWRELLL ALVLTCLACALIVLLLDAIAEYFLTMKDMKMDKEEVKREMKEQEGNPEVKSKRREVHMEI LSEQVKSDIENSRLIVANPTHITIGIYFKPELMPIPMISVYETNQRALAVRAYAEKVGVP VIVDIKLARSLFKTHRRYDLVSLEEIDEVLRLLVWLEEVENAGKDVIQPQENEVRH
Uniprot No.

Target Background

Function
SpaS is involved in a secretory pathway that facilitates the surface presentation of determinants necessary for the entry of Salmonella species into mammalian cells.
Gene References Into Functions
  1. These findings demonstrate that the cleavage event itself does not signal substrate switching but supports the hypothesis that cleavage enables SpaS to adopt the correct conformation, making it competent for its switching function. PMID: 26463164
Database Links

KEGG: stm:STM2887

STRING: 99287.STM2887

Protein Families
Type III secretion exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the advantages of Type III secretion systems for antigen delivery?

The Type III secretion system (T3SS) of Salmonella typhimurium provides several critical advantages for antigen delivery:

  • Direct cytosolic delivery: T3SS can transport heterologous antigens directly into the cytosol of infected cells, bypassing the phagosomal compartment.

  • Enhanced MHC class I presentation: Cytosolic delivery facilitates antigen processing through the proteasome and presentation on MHC class I molecules.

  • Improved CD8+ T cell responses: Direct delivery to the cytosol promotes robust CD8+ T cell priming against delivered antigens.

  • Versatility: The system can be adapted to deliver various antigens from different pathogens.

Research has demonstrated that Salmonella's type III secretion system encoded within the pathogenicity island 1 (SPI-1) can be engineered for effective heterologous antigen delivery. For example, a chimeric protein composed of the first 104 amino acids of the type III secreted protein SopE fused to tumor antigens like NY-ESO-1 can be efficiently secreted into host cells and elicit strong antigen-specific immune responses .

How does inflammasome activation relate to Salmonella-based vaccine efficacy?

Inflammasome activation plays a crucial role in clearance of intracellular bacteria and can significantly impact the efficacy of Salmonella-based vaccines. When specific bacterial components are recognized by intracellular nucleotide-binding domain leucine-rich repeat-containing receptors (NLRs), they can trigger the assembly of inflammasomes. This activation leads to caspase-1 processing, which subsequently drives IL-1β/IL-18 maturation and macrophage pyroptotic death. This pathway represents an important defense mechanism against intracellular bacterial colonization.

Research with recombinant Salmonella strains has shown that engineered bacteria expressing proteins that activate inflammasomes, such as the fusion protein SspH2-EscI (which combines a Salmonella type III secretion system 2 effector with C-terminal EscI from E. coli), can enhance IL-1β and IL-18 secretion, increase pyroptotic cell death of macrophages, and significantly reduce bacterial colonization in the spleen and liver of mice. These findings suggest that strategic inflammasome activation through engineered Salmonella strains can strengthen host defense against Salmonella infection and potentially improve vaccine efficacy .

What are the mechanisms for overcoming Salmonella-containing vacuole (SCV) formation to improve antigen presentation?

The formation of Salmonella-containing vacuoles represents a significant challenge for effective antigen presentation in Salmonella-based vaccine systems. Researchers have developed sophisticated approaches to overcome this limitation, particularly through genetic modifications that prevent SCV formation or enable bacterial release from these compartments.

One notable advanced approach involves the deletion of the sifA gene, which plays a critical role in SCV biogenesis. The sifA deletion (sifA-) prevents Salmonella from forming the protective vacuole, resulting in the release of bacteria into the host cytoplasm. This cytosolic localization significantly enhances antigen presentation to the host immune system by allowing bacterial antigens to access the MHC class I presentation pathway more efficiently.

Additionally, researchers have developed regulated delayed lysis systems that complement the approach to SCV evasion. For example, the χ11246 strain incorporates both the sifA deletion and a regulated delayed lysis mechanism based on the Δasd mutation with arabinose-regulated expression of chromosomal murA gene. When this engineered Salmonella strain invades the arabinose-free host environment, it ultimately lyses and releases plasmid-carrying heterologous virus DNA into the host cytoplasm. This system has been shown to improve the efficiency of immune protection in various applications, including delivery of influenza virus HA and NP proteins .

How can programmed bacterial lysis systems be optimized for antigen delivery while ensuring biological containment?

Programmed bacterial lysis systems represent an advanced approach to both enhance antigen delivery and provide biological containment of recombinant Salmonella vaccines. These systems can be optimized through several sophisticated strategies:

The dual-component approach demonstrated in the research provides an effective model. The first component involves bacterial strain engineering, exemplified by S. typhimurium strain χ8937, which contains deletions of essential peptidoglycan synthesis genes (asdA) and arabinose-regulated expression of another critical gene (murA). The second component is a specialized plasmid (e.g., pYA3681) that encodes arabinose-regulated gene expression and antisense mRNA production.

This system functions through the following mechanism: In laboratory conditions with arabinose, the bacteria grow normally. Upon invasion of host tissues (an arabinose-free environment), transcription of essential genes ceases, and their concentration decreases through cell division. The drop in regulatory protein (C2) concentration activates antisense mRNA synthesis, which blocks translation of any residual mRNA of the essential genes.

Optimization considerations include:

  • Fine-tuning the lysis timing to ensure sufficient colonization and antigen expression before bacterial clearance

  • Balancing between attenuation and immunogenicity

  • Selecting appropriate antigen secretion signals to maximize delivery before lysis occurs

Research has shown this approach can effectively deliver antigens such as the α-helical domain of Streptococcus pneumoniae PspA, generating robust antibody responses while ensuring no viable vaccine strain cells remained in host tissues after 21 days .

What factors affect the efficacy of epitope spreading in Salmonella-delivered tumor antigens?

Epitope spreading represents an important phenomenon in cancer immunotherapy where immune responses initially directed against a specific tumor antigen expand to include responses against additional tumor antigens not contained in the original vaccine. In the context of recombinant Salmonella-delivered tumor antigens, several factors influence the efficacy of this process:

  • Antigen delivery efficiency: The method and efficiency of antigen delivery to antigen-presenting cells directly impacts the primary immune response that precedes epitope spreading. Research with S. typhimurium delivering the NY-ESO-1 tumor antigen through type III secretion showed that antigen presentation by S. typhimurium–NY-ESO-1–infected cells was more efficient than presentation by tumor cells naturally expressing NY-ESO-1.

  • Tumor microenvironment modulation: Salmonella infection can change the tumor microenvironment by recruiting immune cells and altering cytokine profiles, which can enhance cross-presentation of additional tumor antigens.

  • Route of administration: Studies have shown different outcomes between oral administration and intratumoral inoculation of recombinant Salmonella. Intratumoral inoculation of S. typhimurium–NY-ESO-1 to NY-ESO-1–negative tumors resulted in effective antigen delivery in vivo and led to tumor regression in the presence of preexisting NY-ESO-1–specific CD8+ T cells.

  • Inflammatory response: The inflammatory response triggered by Salmonella infection, particularly through inflammasome activation, can enhance dendritic cell maturation and cross-presentation of tumor antigens.

In experimental models, specific T cell responses against at least two unrelated tumor antigens not contained in the vaccine were observed following treatment with S. typhimurium–NY-ESO-1, demonstrating the potential for engineered Salmonella to induce broad anti-tumor immunity through epitope spreading .

How do different Type III secretion system effector proteins compare for heterologous antigen delivery?

Type III secretion system (T3SS) effector proteins serve as crucial carriers for heterologous antigens in recombinant Salmonella vaccine platforms. Their comparative efficacy varies based on several factors:

T3SS EffectorSecretion EfficiencyTiming of ExpressionTarget Subcellular LocationImmune Response ProfileKey Applications
SopEHighEarly infectionCytosolStrong CD8+ T cell responseTumor antigens (e.g., NY-ESO-1)
SspH2ModerateIntracellular phaseCytosol/Cell membraneEnhanced inflammasome activationBacterial/viral antigens
SifAVariableIntracellular phaseSCV membraneLimited MHC-I presentationLess suitable for vaccines

The choice of effector protein significantly impacts delivery efficiency and subsequent immune responses. For example, SopE-based fusion proteins have demonstrated efficient secretion into culture supernatants and have been successfully used to deliver tumor antigens like NY-ESO-1. The first 104 amino acids of SopE appear sufficient for directing secretion of fused heterologous antigens .

In contrast, SspH2, a T3SS2 effector, is expressed during the intracellular phase of infection and can be effectively used to deliver antigens to activate specific immune pathways. Research has shown that fusion proteins combining the N-terminal domain of SspH2 with immunostimulatory proteins like EscI can enhance inflammasome activation and reduce bacterial colonization in vivo .

The timing of expression also differs significantly between effectors associated with different T3SS systems - T3SS1 effectors like SopE are primarily expressed during early infection to mediate bacterial entry, while T3SS2 effectors like SspH2 are expressed once Salmonella enters host cells to mediate intracellular survival .

What are the optimal attenuation strategies for balancing safety and immunogenicity in recombinant Salmonella vaccines?

Developing optimally attenuated Salmonella strains requires careful consideration of genetic modifications that reduce pathogenicity while maintaining immunogenicity. Several attenuation strategies have emerged from recent research:

  • Deletion of virulence genes: The ΔphoP ΔphoQ double deletion creates an avirulent strain that maintains the ability to invade host cells transiently. This approach has been successfully used in Salmonella strains delivering tumor antigens like NY-ESO-1 through type III secretion systems.

  • Regulated delayed attenuation: This sophisticated approach involves engineering strains that display full invasive potential initially but become attenuated after host tissue colonization. For example, arabinose-regulated expression of essential genes allows normal function during in vitro growth (with arabinose) but attenuation in vivo (without arabinose).

  • Essential gene deletions with complementation: Deletion of genes essential for peptidoglycan synthesis (asdA, murA) creates strains that cannot survive without complementation. When these genes are provided on plasmids under regulated promoters, the bacteria remain viable only under specific conditions.

  • Balanced-lethal systems: These systems pair a chromosomal deletion of an essential gene with plasmid-based complementation, ensuring maintenance of the antigen-encoding plasmid.

The χ8937 strain exemplifies a sophisticated approach, combining multiple attenuation mechanisms: deletion of asdA, arabinose-regulated expression of murA, and additional mutations to enhance complete lysis and antigen delivery. When paired with plasmid pYA3681 encoding arabinose-regulated complementary genes, this system demonstrated effective immunogenicity while ensuring no viable vaccine strain cells remained in host tissues after 21 days .

What techniques are most effective for measuring in vivo antigen presentation from recombinant Salmonella strains?

Accurately measuring in vivo antigen presentation from recombinant Salmonella strains requires sophisticated techniques that can assess both bacterial colonization and immune response parameters:

  • Bacterial colonization quantification:

    • Tissue homogenization and selective plating to enumerate viable bacteria in different organs

    • Competitive index assays comparing recombinant strains to reference strains

    • In vivo imaging using bioluminescent or fluorescent Salmonella strains

  • Antigen presentation assessment:

    • Ex vivo restimulation of T cells from immunized animals with specific antigens

    • Tetramer staining to quantify antigen-specific T cells

    • ELISPOT assays to enumerate cytokine-producing cells

    • Flow cytometry to characterize T cell functional profiles (cytokine production, degranulation markers)

  • Inflammasome activation measurement:

    • Quantification of IL-1β and IL-18 in serum or tissue homogenates

    • Assessment of pyroptotic cell death in isolated macrophages

    • Caspase-1 activation assays in tissue samples

Research with recombinant S. typhimurium expressing SspH2-EscI fusion protein demonstrated effective measurement techniques by combining in vitro assays (IL-1β/IL-18 secretion quantification, pyroptotic cell death assessment) with in vivo bacterial colonization studies. These studies revealed significantly lower colonization of the recombinant strain in both spleen and liver compared to control strains, with bacterial counts decreasing over time after infection .

How should researchers design fusion proteins for optimal secretion through Type III secretion systems?

Designing effective fusion proteins for secretion through Type III secretion systems requires careful consideration of multiple structural and functional elements:

  • Secretion signal selection:

    • The N-terminal domain (typically 50-150 amino acids) of native T3SS-secreted effectors serves as an effective secretion signal

    • Common effective signals include the first 104 amino acids of SopE or the N-terminus of SspH2

    • The signal sequence should be directly fused to the heterologous antigen without intervening sequences that might disrupt secretion

  • Antigen properties optimizations:

    • Size limitations: Larger antigens may reduce secretion efficiency

    • Folding considerations: Complex folding domains may interfere with secretion

    • Codon optimization: Adapting codons to Salmonella usage can improve expression

    • Avoiding sequences that might be targeted for degradation in Salmonella

  • Expression control:

    • Promoter selection: Native T3SS promoters or regulated promoters (e.g., arabinose-inducible)

    • Considering timing of expression relative to infection stage

    • Balancing expression levels to avoid toxicity while maintaining immunogenicity

  • Experimental validation methods:

    • Western blotting of culture supernatants to confirm secretion

    • Immunofluorescence microscopy to visualize delivery to host cells

    • In vitro infection assays to assess functional delivery to target cells

In research applications, chimeric proteins like the SopE-NY-ESO-1 fusion (comprising the first 104 amino acids of SopE fused to the NY-ESO-1 tumor antigen) have demonstrated efficient secretion. Similarly, the SspH2-EscI fusion protein, combining the N-terminal secretion signal of SspH2 with the C-terminus of E. coli EscI protein, has proven effective for delivery into macrophages to activate inflammasome responses .

What are the appropriate controls and variables to consider when evaluating Salmonella-based antigen delivery systems?

Rigorous evaluation of Salmonella-based antigen delivery systems requires careful selection of controls and variables:

Essential controls:

  • Empty vector control: Salmonella carrying the same plasmid backbone without the antigen gene to distinguish antigen-specific effects from vector effects.

  • Non-secreting antigen control: Salmonella expressing the antigen without secretion signals to assess the importance of delivery mechanism.

  • Non-attenuated vs. attenuated comparison: To evaluate the impact of attenuation on colonization and immune response.

  • Purified antigen control: Direct administration of the purified antigen to compare standard vaccination with the Salmonella delivery approach.

Critical variables to control:

VariableImportanceMeasurement Methods
Bacterial inoculum doseAffects colonization and immune response magnitudeCFU counts before administration
Route of administrationDetermines initial colonization sites and immune response typeStandardized delivery protocols
Animal model characteristicsAge, sex, microbiome composition influence outcomesConsistent animal sourcing, housing conditions
Timing of analysisImmune responses evolve over timeMultiple timepoint sampling
Pre-existing immunityCan alter new immune responsesSerological screening before experiments

Specific examples from research:

In studies of Salmonella delivering tumor antigens, appropriate controls included S. typhimurium strain carrying only the secretion signal without the antigen. When evaluating inflammasome activation by SspH2-EscI fusion protein, researchers compared the recombinant strain X4550(pYA3334-SspH2-EscI) with control strain X4550(pYA3334-SspH2) lacking the EscI domain. This controlled comparison revealed that the SspH2-EscI fusion significantly enhanced IL-1β and IL-18 secretion and pyroptotic cell death of mouse peritoneal macrophages compared to the control strain .

What are the most promising directions for improving Salmonella-based antigen delivery systems?

Based on current research findings, several promising directions emerge for enhancing Salmonella-based antigen delivery systems:

  • Combined secretion and lysis approaches: Integrating regulated delayed lysis systems with efficient secretion mechanisms could maximize antigen delivery while ensuring bacterial clearance. The development of strains like χ8937 with programmed lysis capabilities represents a significant advance in this direction.

  • Multi-antigen delivery systems: Engineering Salmonella to simultaneously deliver multiple antigens could generate broader immune responses against complex pathogens or tumors. This approach could leverage the epitope spreading phenomenon observed with tumor antigens.

  • Tailored inflammasome activation: Strategic activation of specific inflammasome pathways through engineered fusion proteins like SspH2-EscI could enhance immunity while limiting excessive inflammation that might impair vaccine efficacy.

  • Microbiome-aware vaccine design: Considering interactions between vaccine strains and the gut microbiome could improve colonization and immune responses in diverse populations.

  • Tissue-specific antigen delivery: Developing strains with enhanced tropism for specific tissues or cell types could improve vaccine efficacy for particular diseases.

These approaches promise to enhance both the safety and efficacy of Salmonella-based antigen delivery systems, potentially expanding their application in infectious disease prevention, cancer immunotherapy, and other fields requiring targeted immune activation .

How do different mouse models affect the assessment of Salmonella-based vaccine efficacy?

Mouse models significantly impact the assessment of Salmonella-based vaccine efficacy, with several key considerations:

  • Strain-dependent susceptibility: Different mouse strains exhibit varying susceptibility to Salmonella infection. C57BL/6 mice carry functional Nramp1 (Slc11a1) alleles conferring resistance to Salmonella, while BALB/c mice are more susceptible due to defective Nramp1. This genetic variation affects bacterial clearance rates and immune response patterns.

  • Immune response bias: Mouse strains display inherent biases in their immune responses. BALB/c mice tend toward Th2-dominated responses, while C57BL/6 mice favor Th1 responses, directly impacting the type of immunity generated against delivered antigens.

  • Microbiome variations: The intestinal microbiome composition, which varies between mouse strains and housing facilities, can significantly influence colonization by Salmonella vaccines and subsequent immune responses.

  • Age and sex factors: Both age and sex of mice impact immune response strength and character, with young female mice often showing stronger responses to some vaccines than males or older animals.

When evaluating colonization of recombinant Salmonella expressing fusion proteins like SspH2-EscI, researchers have observed significant differences in bacterial counts between spleen and liver, with the recombinant strain showing decreasing counts over time while control strains increased. These tissue-specific differences highlight the importance of comprehensive sampling across multiple organ systems when assessing vaccine efficacy in mouse models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.