Recombinant Salmonella typhimurium Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Description

Role in Copper Resistance

DsbD interacts with the ScsABCD system to mitigate copper toxicity. Experimental data demonstrate its auxiliary role in maintaining copper tolerance under stress :

StrainMIC for CuSO₄ (mM)Phenotype
Wild-type4.75Normal growth
ΔdsbD4.75Minor growth defect at 4.75 mM
ΔscsB3.5Severe sensitivity
ΔdsbD ΔscsB3.0Synergistic sensitivity

Deletion of dsbD alone does not significantly impair copper resistance, but its loss exacerbates sensitivity in ΔscsB mutants, highlighting functional redundancy with the Scs system .

Contribution to Virulence

DsbD supports the activity of disulfide isomerases (e.g., DsbC and DsbG), which are essential for folding virulence factors such as:

  • Type III Secretion Systems (T3SS): Required for invasion of host cells .

  • Flagellar Assembly: Critical for motility and biofilm formation .

In murine infection models, dsbD mutants exhibit attenuated virulence, with reduced intracellular replication in macrophages and impaired survival in BALB/c mice .

Interactions with Other Redox Systems

DsbD operates within a network of redox enzymes:

  • DsbA/DsbB: Primary oxidase pathway for de novo disulfide bond formation .

  • ScsABCD: Copper-responsive system where ScsC (a DsbA-like protein) collaborates with DsbD to rectify copper-induced oxidative damage .

  • Thioredoxin 1 (TrxA): Cytoplasmic electron donor for DsbD, linking cytoplasmic and periplasmic redox states .

Research Applications

Recombinant DsbD is produced in E. coli for structural and functional studies. Key parameters include :

  • Purity: >90% (verified by SDS-PAGE).

  • Sequence: 546 residues with a His-tag for purification.

  • Storage: Stable in Tris/PBS buffer with 6% trehalose at -80°C.

Key Research Findings

  • Redox Potential: DsbD’s midpoint reduction potential (-132 mV) enables it to reduce aberrant disulfides in substrate proteins .

  • Genetic Regulation: Transcription of dsbD is indirectly influenced by the CpxR/CpxA two-component system under copper stress .

  • Pathogen-Specific Adaptations: Unlike E. coli, Salmonella DsbD cannot compensate for the loss of ScsB, underscoring its specialized role in virulence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbD; STM4323; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-567
Protein Length
Full Length of Mature Protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
dsbD
Target Protein Sequence
GLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQL PTGVWHEDEFYGKSEIYRKRLNVPVTVNQAAAGATLTVTYQGCADAGFCYPPETKTVPLS EVAAAIDATPTPAVTQTSETSKPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLG GRQRLSTGRALLLAFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLA LSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYI AQSGNMWLGGGTLYLYALGMGLPLMLVTVFGNRLLPKSGPWMAHVKTAFGFVILALPVFL LERIIGEAWGLRLWSLLGVAFFGWAFITSLQARRAWMRIVQIILLAAALISVRPLQDWAF GSPSAQAPAHLNFTAISTVDELNQALAQAKGKPVMLDFYADWCVACKEFEKYTFSDPRVQ QALGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFNTQGQEQPQSRVTGFMDAATFS AHLHDRQP
Uniprot No.

Target Background

Function
DsbD is essential for facilitating the formation of correct disulfide bonds in certain periplasmic proteins and for the assembly of periplasmic c-type cytochromes. It functions by transferring electrons from cytoplasmic thioredoxin to the periplasm. This transfer involves a series of disulfide bond formation and reduction steps.
Database Links

KEGG: stm:STM4323

STRING: 99287.STM4323

Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of DsbD in Salmonella typhimurium?

DsbD in Salmonella typhimurium functions as a transmembrane electron transporter that transfers reducing equivalents from the cytoplasm to the periplasm. This protein is essential for the reduction of oxidized DsbC and DsbG proteins, which are disulfide isomerases that correct non-native disulfide bonds in misfolded proteins. The DsbD-mediated electron transfer pathway is critical for maintaining the redox balance in the bacterial periplasm and ensuring proper protein folding, particularly for proteins containing multiple disulfide bonds. Unlike some other redox proteins, DsbD specifically transfers electrons rather than directly catalyzing disulfide bond formation or isomerization .

How does DsbD differ structurally from other thiol:disulfide interchange proteins?

DsbD differs from other thiol:disulfide interchange proteins through its unique three-domain architecture. The protein consists of:

  • An N-terminal periplasmic domain (nDsbD)

  • A central transmembrane domain (tDsbD) with eight transmembrane segments

  • A C-terminal periplasmic domain (cDsbD)

Each domain contains a pair of active site cysteines that participate in a sequential disulfide exchange cascade. This structure enables DsbD to transport electrons across the cytoplasmic membrane from thioredoxin in the cytoplasm to various redox proteins in the periplasm. Unlike DsbA and DsbC, which contain only periplasmic domains, DsbD's transmembrane structure allows it to connect the cytoplasmic and periplasmic redox environments, making it functionally distinct from other Dsb family proteins .

How is recombinant DsbD protein typically expressed in laboratory settings?

Recombinant DsbD protein expression typically utilizes specialized expression systems that address the challenges of membrane protein production. A common approach involves:

  • Cloning the dsbD gene into expression vectors with inducible promoters (such as T7 or arabinose-inducible systems)

  • Transforming the construct into E. coli expression strains optimized for membrane proteins (C41(DE3), C43(DE3), or Lemo21)

  • Culturing cells at lower temperatures (16-20°C) following induction to slow protein synthesis and facilitate proper folding

  • Using mild detergents (DDM, LDAO, or C12E8) for membrane solubilization during purification

  • Including reducing agents (DTT or TCEP) throughout purification to maintain the redox state of the critical cysteine residues

For functional studies, researchers often express only the soluble periplasmic domains (nDsbD or cDsbD) rather than the full-length protein, as these domains are easier to produce in soluble form and can be used for many biochemical analyses .

What experimental approaches can be used to study the electron transfer mechanism of DsbD?

The electron transfer mechanism of DsbD can be studied using multiple complementary approaches:

  • Site-directed mutagenesis: Systematic mutation of the conserved cysteine residues in each domain (nDsbD, tDsbD, cDsbD) to alanine or serine, followed by functional assays to determine the importance of each residue in the electron transfer pathway.

  • Stopped-flow kinetics: Rapid mixing of purified DsbD domains with electron donors/acceptors while monitoring the reaction using spectroscopic techniques can reveal the rate constants of individual electron transfer steps.

  • Protein crystallography: Structures of individual domains or full-length DsbD in different redox states can provide insights into conformational changes associated with electron transfer.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of DsbD that undergo conformational changes during the catalytic cycle.

  • Pulse radiolysis: Generation of free electrons by irradiation of aqueous solutions can be used to study the electron transfer kinetics within DsbD's domains.

A comprehensive approach would combine these methods with computational modeling to develop a complete understanding of the electron transfer process through the protein .

How do mutations in dsbD affect Salmonella typhimurium virulence compared to wild-type strains?

Mutations in dsbD significantly impact Salmonella typhimurium virulence through multiple mechanisms:

  • Periplasmic protein misfolding: DsbD-deficient strains show impaired function of virulence factors requiring correct disulfide bond formation, particularly those containing non-consecutive disulfide bonds.

  • Stress response alterations: Analysis of dsbD mutants reveals heightened sensitivity to oxidative stress encountered within macrophages during infection.

  • Tissue colonization defects: Unlike wild-type strains that proliferate in host tissues, dsbD mutants show patterns similar to nonvirulent Salmonella abony, failing to multiply effectively in blood, liver, and spleen following intravenous challenge.

  • Reduced survival in serum: DsbD mutants typically demonstrate longer doubling times in mouse serum compared to wild-type strains, correlating with decreased virulence.

  • Altered immune clearance dynamics: While dsbD mutations don't necessarily enhance phagocytosis rates, they can prevent the bacteria from surviving and replicating within phagocytic cells.

This multifaceted impact on virulence makes dsbD an interesting target for attenuated vaccine development and antimicrobial strategies .

What are the key considerations when designing recombinant Salmonella typhimurium strains with modified DsbD for vaccine development?

When designing recombinant Salmonella typhimurium strains with modified DsbD for vaccine development, researchers should consider:

  • Attenuation balance: Modifications to DsbD must sufficiently attenuate virulence while maintaining immunogenicity. Complete deletion often creates strains that are rapidly cleared before establishing adequate immune responses.

  • Domain-specific modifications: Consider targeted mutations to specific DsbD domains rather than whole protein deletion. For example, mutations in the nDsbD domain might attenuate virulence while preserving basic viability.

  • Antigen expression stability: Modified DsbD strains must maintain stable expression of recombinant antigens. The redox environment affects protein folding, so changes to DsbD function may impact the display of heterologous antigens.

  • Safety assessment: Comprehensive testing must ensure that DsbD-modified strains cannot revert to virulence through genetic recombination or mutation.

  • Immune response characterization: Detailed analysis of both humoral and cell-mediated responses against both Salmonella antigens and heterologous antigens should be conducted.

  • Strain persistence: The ability of modified strains to persist long enough to stimulate protective immunity without causing disease must be carefully balanced through controlled modifications to DsbD function .

How should researchers design experiments to compare wild-type and recombinant DsbD function in Salmonella typhimurium?

When designing experiments to compare wild-type and recombinant DsbD function in Salmonella typhimurium, a comprehensive approach should include:

  • Defining variables clearly:

    • Independent variables: DsbD protein variants (wild-type, recombinant variants, deletion mutants)

    • Dependent variables: Growth rates, stress resistance, virulence indicators, protein folding efficiency

    • Controlled variables: Culture conditions, genetic background, expression levels

  • Complementation analysis:

    • Create a clean dsbD deletion strain

    • Complement with wild-type dsbD on plasmid (positive control)

    • Complement with recombinant variants on identical plasmid backbones

    • Include empty vector control (negative control)

  • Phenotypic characterization:

    • Growth curves under standard and stress conditions (oxidative, pH, temperature)

    • Sensitivity to redox-active compounds (copper, hydrogen peroxide, diamide)

    • Motility and biofilm formation assays

    • Periplasmic enzyme activity assays to assess protein folding

  • Molecular characterization:

    • Western blot analysis of DsbD expression levels

    • Redox state analysis of periplasmic proteins using AMS or mPEG-mal labeling

    • Co-immunoprecipitation to identify interaction partners

  • Virulence assessment:

    • Cell invasion assays

    • Macrophage survival assays

    • Animal models if appropriate (with proper ethical approval)

This structured experimental design ensures systematic evaluation of functional differences between wild-type and recombinant DsbD proteins .

What controls are essential when studying the redox properties of DsbD in vitro?

When studying the redox properties of DsbD in vitro, the following controls are essential:

  • Redox buffer controls:

    • Establish and maintain defined redox potentials using buffered glutathione (GSH/GSSG) or DTT (reduced/oxidized) systems

    • Include redox potential calibration standards

    • Monitor buffer redox potential throughout experiments using redox-sensitive dyes or electrodes

  • Protein state controls:

    • Fully reduced DsbD (treatment with excess DTT or TCEP)

    • Fully oxidized DsbD (treatment with oxidants like diamide or copper phenanthroline)

    • Heat-denatured protein (negative control for activity)

  • Reaction specificity controls:

    • Catalytically inactive DsbD variants (Cys→Ala mutations at active sites)

    • Non-specific thiol proteins (e.g., BSA with reduced cysteines)

    • Buffer-only reactions (no protein)

  • Environmental condition controls:

    • Temperature consistency (±0.5°C)

    • pH series to assess pH-dependence of reactions

    • Oxygen-free conditions for anaerobic redox studies

    • Metal chelators to control trace metal effects

  • Time-course controls:

    • Multiple time points to establish reaction kinetics

    • Quenched reactions at t=0 to establish baselines

These controls enable accurate interpretation of experimental results by distinguishing specific DsbD-mediated redox activities from non-specific or environmental effects .

How can researchers effectively analyze the impact of DsbD mutations on protein interactions in the bacterial periplasm?

Researchers can effectively analyze the impact of DsbD mutations on protein interactions in the bacterial periplasm through a multi-faceted approach:

  • In vivo crosslinking coupled with mass spectrometry:

    • Treat living bacteria with membrane-permeable crosslinkers

    • Immunoprecipitate DsbD (wild-type or mutant)

    • Identify crosslinked partners by mass spectrometry

    • Compare interaction profiles between wild-type and mutant DsbD

  • Bacterial two-hybrid systems modified for periplasmic proteins:

    • Adapt split-protein complementation assays for periplasmic use

    • Screen for interactions between DsbD variants and potential partners

    • Quantify interaction strength through reporter gene expression

  • Surface plasmon resonance (SPR) with purified components:

    • Immobilize purified DsbD domains on sensor chips

    • Measure binding kinetics with purified partner proteins

    • Compare wild-type and mutant binding parameters (kon, koff, KD)

  • Genetic suppressor screens:

    • Identify suppressors of dsbD mutation phenotypes

    • Map suppressor mutations to interaction partners

    • Validate genetic interactions through biochemical approaches

  • Redox state profiling of partner proteins:

    • Use thiol-reactive agents (AMS, NEM) to trap redox states

    • Compare redox states of partner proteins in wild-type vs. dsbD mutant backgrounds

    • Identify which interactions are redox-dependent

This integrated approach provides a comprehensive understanding of how specific DsbD mutations affect its interaction network in the periplasmic space .

How should researchers interpret conflicting data on DsbD activity in different experimental systems?

When faced with conflicting data on DsbD activity across different experimental systems, researchers should follow this methodological framework:

  • System-specific variable analysis:

    • Create a comprehensive comparison table of experimental conditions:

    ParameterSystem ASystem BSystem CPotential Impact
    Expression hostE. coliS. typhimuriumCell-freeHost factors may supplement/inhibit activity
    Buffer compositionHEPES pH 7.5Phosphate pH 7.0Tris pH 8.0pH affects thiol reactivity; buffer components may interact with protein
    Temperature25°C37°C30°CAffects protein dynamics and reaction rates
    Redox potential-280 mV-320 mVNot controlledDirectly impacts thiol-disulfide exchange reactions
    Detergent (if used)DDM 0.03%LDAO 0.1%FC-12 0.05%Different effects on membrane protein structure/function
  • Mechanistic reconciliation:

    • Determine if conflicts are quantitative (different rates) or qualitative (different mechanisms)

    • Develop testable hypotheses explaining how system differences could lead to observed variations

    • Design bridging experiments that systematically vary conditions between the conflicting systems

  • Technical validation:

    • Cross-validate methods between laboratories

    • Ensure protein preparations have comparable purity and redox states

    • Verify activity measurements using complementary techniques

  • Physiological relevance assessment:

    • Evaluate which system most closely mimics the native periplasmic environment

    • Prioritize data from systems that reconstitute physiological protein partners and conditions

  • Computational modeling:

    • Use molecular dynamics simulations to predict how different conditions affect DsbD structure/function

    • Develop mathematical models that incorporate system-specific variables to explain divergent results

This systematic approach transforms conflicting data from a problem into an opportunity to discover condition-dependent aspects of DsbD function .

What statistical approaches are most appropriate for analyzing DsbD activity data from multiple strains?

When analyzing DsbD activity data from multiple Salmonella typhimurium strains, the following statistical approaches are most appropriate:

  • Preliminary data exploration:

    • Shapiro-Wilk test to assess normality of distribution

    • Levene's test to evaluate homogeneity of variances

    • Box plots and Q-Q plots to visualize data distributions

  • Comparative analysis between strains:

    • For normally distributed data with homogeneous variances:

      • One-way ANOVA followed by Tukey's HSD for multiple comparisons

      • Student's t-test for pairwise comparisons (with Bonferroni correction)

    • For non-parametric analysis (when assumptions aren't met):

      • Kruskal-Wallis test followed by Dunn's test for multiple comparisons

      • Mann-Whitney U test for pairwise comparisons

    • For small sample sizes:

      • Bootstrap resampling to estimate confidence intervals

      • Permutation tests to determine significance

  • Multivariate approaches for complex datasets:

    • Principal Component Analysis (PCA) to identify patterns across multiple DsbD activity parameters

    • Hierarchical clustering to group strains with similar DsbD function profiles

    • MANOVA when analyzing multiple dependent variables simultaneously

  • Regression analysis for relationship identification:

    • Linear regression for relationships between DsbD activity and continuous variables

    • Logistic regression for binary outcomes (e.g., virulence/non-virulence)

  • Experimental design considerations:

    • Power analysis to determine appropriate sample sizes

    • Mixed-effects models for repeated measures designs

    • Bayesian approaches when incorporating prior knowledge about DsbD function

This comprehensive statistical toolkit ensures robust, reproducible analysis of complex DsbD activity datasets, providing appropriate methods for both hypothesis testing and exploratory analysis .

How can researchers distinguish between direct and indirect effects of DsbD mutations on Salmonella typhimurium phenotypes?

Distinguishing between direct and indirect effects of DsbD mutations requires a systematic approach combining genetic, biochemical, and systems-level analyses:

  • Genetic approach:

    • Create an allelic series of dsbD mutations (from point mutations to complete deletions)

    • Generate domain-specific variants affecting only certain DsbD functions

    • Construct double mutants with interacting partners to identify epistatic relationships

    • Implement conditional expression systems to separate developmental from functional effects

  • Biochemical verification:

    • Directly measure DsbD enzymatic activity in wild-type and mutant strains

    • Assess redox states of known DsbD substrates using alkylation-shift assays

    • Perform in vitro reconstitution with purified components to verify direct interactions

    • Quantify disulfide isomerization activity in periplasmic extracts

  • Systems-level analysis:

    • Compare global proteomics profiles between wild-type and dsbD mutants

    • Identify differentially expressed proteins and map to cellular pathways

    • Measure specific activities of periplasmic enzymes dependent on disulfide bonds

    • Analyze envelope stress response activation as indicator of indirect effects

  • Temporal analysis:

    • Use time-course experiments to establish causality

    • Implement pulse-chase approaches to track primary versus secondary effects

    • Apply inducible expression systems to determine immediate versus delayed responses

  • Computational modeling:

    • Develop network models incorporating known DsbD interactions

    • Simulate effects of DsbD perturbation on downstream processes

    • Predict direct versus indirect effects based on network architecture

This integrated approach allows researchers to confidently distinguish primary effects directly attributable to DsbD function from secondary consequences arising from cellular adaptation to redox imbalance .

How can DsbD be utilized in designing attenuated Salmonella typhimurium vaccine vectors?

DsbD can be strategically utilized in designing attenuated Salmonella typhimurium vaccine vectors through several approaches:

  • Targeted attenuation strategies:

    • Partial function mutations: Introduce point mutations in critical cysteine residues to reduce but not eliminate DsbD function

    • Domain-specific modifications: Alter specific domains to impact particular interaction partners

    • Conditional expression: Place dsbD under control of in vivo-attenuated promoters

  • Antigen presentation enhancement:

    • Create DsbD variants optimized for correct folding of specific vaccine antigens

    • Engineer chimeric DsbD proteins that incorporate immunodominant epitopes

    • Modify DsbD to preferentially interact with recombinant antigens requiring disulfide bond formation

  • Immunological balance optimization:

    • Fine-tune DsbD function to achieve:

      • Sufficient attenuation for safety

      • Adequate persistence for immune priming

      • Optimal stress response activation for adjuvant effect

  • Stability and safety features:

    • Introduce multiple independent mutations to prevent reversion

    • Design strains with complementary attenuating mutations in DsbD and other virulence systems

    • Incorporate biosafety features like auxotrophic markers alongside DsbD modifications

  • Evaluation matrix for DsbD-modified vaccine vectors:

    ParameterAssessment MethodTarget Profile
    Attenuation levelLD50 determination>10^6 increase vs. wild-type
    Antigen expressionFlow cytometry, Western blotStable expression for >10 generations
    Tissue persistenceCompetitive index assayDetectable for 7-10 days post-immunization
    Immune responseELISPOT, antibody titersBalanced Th1/Th2/Th17 profile
    Safety marginImmunocompromised model challengeNo disease in severely immunodeficient hosts

This structured approach leverages DsbD's essential role in virulence while preserving the immunostimulatory properties required for effective vaccine vectors .

What methodologies can be employed to study DsbD-mediated protein folding pathways in the periplasm?

Multiple complementary methodologies can be employed to study DsbD-mediated protein folding pathways in the periplasm:

  • Real-time folding assays:

    • Pulse-chase experiments with radiolabeled proteins

    • Fluorescence resonance energy transfer (FRET)-based sensors that report on disulfide bond formation

    • Split-GFP complementation systems adapted for periplasmic expression

    • Folding-dependent protease protection assays

  • Redox state analysis:

    • Alkylation-shift assays using maleimide-PEG (mPEG-mal) or 4-acetamido-4'-maleimidylstilbene-2,2'-disulfonic acid (AMS)

    • Redox proteomics using isotope-coded affinity tags (ICAT)

    • Diagonal electrophoresis to separate oxidized from reduced species

    • Mass spectrometry to map disulfide bond connectivities

  • Genetic approaches:

    • dsbD suppressor screens to identify novel pathway components

    • Synthetic genetic arrays to map genetic interactions

    • Conditional depletion systems to study essential components

    • Reporter fusions that activate upon misfolding

  • Structural biology methods:

    • Time-resolved crystallography to capture folding intermediates

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Nuclear magnetic resonance (NMR) to study conformational changes during folding

    • Cryo-electron microscopy of DsbD-substrate complexes

  • Systems-level approaches:

    • Global proteomic profiling of disulfide bond formation kinetics

    • Computational modeling of electron flow through the Dsb system

    • Network analysis of redox-dependent protein interactions

    • Machine learning to predict DsbD-dependent substrate folding pathways

This integrated methodology toolkit enables researchers to unravel the complex spatial and temporal dynamics of DsbD-mediated protein folding in the bacterial periplasm .

What emerging technologies might advance our understanding of DsbD function in Salmonella typhimurium?

Several emerging technologies show particular promise for advancing our understanding of DsbD function in Salmonella typhimurium:

  • CRISPR-Cas9 genome editing applications:

    • Base editing for precise mutation of catalytic cysteines without DSB repair

    • CRISPRi/CRISPRa for tunable repression/activation of dsbD expression

    • CRISPR screening to identify genetic interactions with dsbD

    • Prime editing for scarless introduction of specific mutations

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize DsbD localization patterns

    • Single-molecule FRET to observe conformational changes during electron transfer

    • Correlative light and electron microscopy (CLEM) to link DsbD function to ultrastructure

    • Expansion microscopy adapted for bacterial cells to visualize protein complexes

  • Synthetic biology approaches:

    • Engineered allosteric DsbD variants with controllable activity

    • Orthogonal redox pairs to study electron flow pathways

    • Minimal synthetic electron transport chains incorporating DsbD

    • Biosensors reporting on DsbD activity in real-time

  • High-throughput phenotypic profiling:

    • Transposon sequencing (Tn-Seq) in various DsbD backgrounds

    • Bacterial cytological profiling to characterize phenotypic signatures

    • Droplet microfluidics for single-cell analysis of DsbD function

    • Deep mutational scanning of DsbD to map sequence-function relationships

  • Computational and structural biology innovations:

    • AlphaFold2 and RoseTTAFold for structure prediction of DsbD complexes

    • Molecular dynamics simulations of electron transfer through DsbD

    • Systems biology models integrating redox homeostasis networks

    • Cryo-electron tomography to visualize DsbD in its native membrane environment

These technologies, particularly when applied in combination, promise to reveal new aspects of DsbD function that have remained elusive with conventional approaches .

How might our understanding of DsbD function inform development of novel antimicrobial strategies?

Our understanding of DsbD function can inform the development of novel antimicrobial strategies through multiple promising approaches:

  • Direct targeting of DsbD function:

    • Small molecule inhibitors that block electron transfer between DsbD domains

    • Peptide-based drugs that mimic substrate binding sites to competitively inhibit interactions

    • Covalent modifiers targeting the conserved cysteine residues in DsbD

    • Antibodies or nanobodies against extracellular DsbD domains

  • Pathway-based approaches:

    • Compounds that disrupt the interaction between DsbD and its partners (DsbC, CcmG)

    • Molecules that accelerate oxidation of the DsbD active site, depleting its reduction capacity

    • Dual-targeting strategies affecting both DsbA and DsbD to compromise the entire disulfide bond formation system

    • Redox cycling compounds that specifically deplete periplasmic reducing power

  • Vulnerability exploitation:

    • Stress inducers that overwhelm the capacity of the compromised disulfide isomerization system

    • Sensitizing agents that make dsbD-deficient bacteria more susceptible to existing antibiotics

    • β-lactam potentiators targeting the cell envelope weaknesses in DsbD-compromised cells

    • Biofilm dispersal agents targeting DsbD-dependent matrix proteins

  • Screening and development strategy:

    ApproachAdvantagesChallengesTimeline
    High-throughput screeningIdentifies novel chemical scaffoldsMay yield non-specific hits2-3 years
    Structure-based designRational approach with higher specificityRequires detailed structural information3-5 years
    Fragment-based discoveryIdentifies high-efficiency binding elementsComplex optimization process3-4 years
    Repurposing existing compoundsFaster development pathLimited by existing chemical space1-2 years
    Peptide mimeticsHigh specificity for protein-protein interfacesDelivery challenges2-4 years
  • Resistance mitigation strategies:

    • Multi-targeting approaches affecting redundant pathways

    • Evolutionary constraint analysis to identify sites with low tolerance for mutations

    • Combination therapies that prevent resistance development

    • Collateral sensitivity exploitation where resistance to one agent increases sensitivity to another

This multifaceted approach leverages our deep understanding of DsbD biology to create antimicrobials with novel mechanisms of action, addressing the critical need for new strategies against resistant pathogens .

What integrated research approaches would provide the most comprehensive understanding of DsbD function in Salmonella typhimurium?

A truly comprehensive understanding of DsbD function in Salmonella typhimurium requires integration of multiple research approaches spanning different scales of biological organization:

  • Multi-scale temporal and spatial investigation:

    • Atomic scale: Quantum mechanical modeling of electron transfer chemistry

    • Molecular scale: Structural studies of DsbD domains and complexes

    • Cellular scale: Systems biology of the disulfide bond formation network

    • Organismal scale: In vivo infection studies with DsbD variants

    • Population scale: Evolution experiments tracking DsbD adaptations

  • Interdisciplinary methodology integration:

    • Structural biology to determine conformational states

    • Biochemistry to characterize enzymatic mechanisms

    • Genetics to establish functional relationships

    • Microbiology to assess physiological impacts

    • Immunology to understand host-pathogen interactions

    • Computational biology to model complex systems behavior

  • Complementary experimental paradigms:

    • Reductionist approaches isolating specific components

    • Holistic approaches preserving native context

    • Forward genetics identifying new components

    • Reverse genetics validating predicted functions

    • In vitro reconstitution verifying direct mechanisms

    • In vivo studies confirming physiological relevance

  • Dynamic investigation framework:

    • Steady-state analysis establishing baseline function

    • Perturbation studies revealing regulatory mechanisms

    • Stress response characterization identifying adaptive roles

    • Evolutionary analysis uncovering selective pressures

    • Comparative studies across Salmonella strains revealing specialization

  • Translational research integration:

    • Basic mechanistic studies informing applied research

    • Vaccine development efforts providing in vivo insights

    • Antimicrobial discovery revealing functional vulnerabilities

    • Clinical isolate analysis connecting to human infections

This integrated research program, while ambitious, would provide a comprehensive understanding of DsbD function that spans from fundamental biophysics to applied clinical relevance, revealing how this fascinating protein contributes to Salmonella typhimurium physiology, pathogenesis, and adaptation .

How should researchers prioritize studies on DsbD in the context of broader Salmonella pathogenesis research?

Researchers should prioritize studies on DsbD in Salmonella pathogenesis research following this evidence-based framework:

  • Establish a decision matrix with weighted criteria:

    • Scientific significance (30%): Fundamental knowledge gaps about redox biology

    • Clinical relevance (25%): Connection to human salmonellosis

    • Technological feasibility (20%): Available methods to address questions

    • Translational potential (15%): Applications in vaccines or therapeutics

    • Resource requirements (10%): Cost-effectiveness of research approach

  • High-priority research areas based on current knowledge gaps:

    • Determine the DsbD-dependent redox proteome during infection

    • Characterize host-induced changes in DsbD function and regulation

    • Identify tissue-specific requirements for DsbD during different infection stages

    • Map the complete electron transfer network in Salmonella periplasm

    • Develop DsbD-targeted antimicrobials with novel mechanisms of action

  • Strategic integration with core Salmonella research questions:

    • Incorporate DsbD studies into investigations of virulence factor secretion

    • Include DsbD variants in global studies of Salmonella adaptation to host environments

    • Position DsbD research within broader envelope stress response investigations

    • Connect DsbD function to established pathogenicity mechanisms

  • Balanced research portfolio approach:

    • Maintain parallel tracks of fundamental and applied research

    • Ensure representation of DsbD studies across different technological approaches

    • Develop both short-term projects with immediate applications and long-term foundational studies

    • Create collaborative networks linking DsbD specialists with broader Salmonella research community

  • Adaptive prioritization process:

    • Establish regular reassessment points to evaluate progress

    • Maintain flexibility to pursue unexpected discoveries

    • Adjust priorities based on emerging technologies and findings

    • Respond to shifts in clinical needs and funding landscapes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.