Recombinant Salmonella typhimurium Tyrosine-protein kinase wzc (wzc)

What is Tyrosine-protein kinase wzc in Salmonella typhimurium and what is its biological function?

Tyrosine-protein kinase wzc (UniProt No. Q9F7B1) is a crucial protein in Salmonella typhimurium strain LT2/SGSC1412/ATCC 700720 with enzymatic classification EC 2.7.10.- . The wzc gene (STM2116) encodes a protein involved in bacterial polysaccharide biosynthesis and export regulation. From a functional perspective, wzc participates in phosphorylation cascades that regulate capsular polysaccharide production, which contributes to biofilm formation and bacterial virulence.

The protein contains both transmembrane domains and cytoplasmic catalytic regions, as evidenced by its amino acid sequence. The transmembrane architecture suggests that wzc spans the bacterial cell membrane, positioning it ideally to transduce signals between the extracellular environment and intracellular metabolic machinery. This positioning is critical for its role in coordinating polysaccharide export with biosynthesis.

What are the optimal storage conditions for recombinant wzc protein preparations?

Storage conditions directly impact the stability and activity of recombinant wzc protein. For optimal preservation:

• Liquid formulations maintain activity for approximately 6 months when stored at -20°C to -80°C

• Lyophilized preparations have extended stability, maintaining viability for up to 12 months at -20°C to -80°C

• Working aliquots should be maintained at 4°C for no longer than one week

• Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided

The stability profile indicates that the protein has moderate temperature sensitivity but can be effectively preserved through proper storage protocols. For applications requiring consistent enzymatic activity, researchers should implement strict temperature control protocols throughout experimental workflows.

What reconstitution protocols are recommended for experimental applications?

Proper reconstitution is essential for maintaining wzc functionality. Follow these methodological steps for optimal results:

• Briefly centrifuge the protein vial before opening to collect all material at the bottom

• Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL

• For long-term storage of working solutions, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

• Aliquot the reconstituted protein into single-use volumes to prevent repeated freeze-thaw cycles

• For storage buffer considerations, a Tris-based buffer with 50% glycerol has been shown to maintain optimal protein stability

These reconstitution parameters ensure that the protein maintains structural integrity and enzymatic activity, which are critical for downstream applications including kinase activity assays, protein-protein interaction studies, and structural analyses.

What expression systems yield optimal production of functional recombinant wzc protein?

The expression system selection significantly impacts the quality, yield, and functionality of recombinant wzc protein. Current evidence indicates:

• Mammalian cell expression systems have successfully produced recombinant wzc with purity levels exceeding 85% as verified by SDS-PAGE analysis

• The full-length protein (amino acids 1-719) or functional domains may be selected based on specific experimental requirements

• Expression construct design should account for the complete coding sequence: MTEKAKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADAL VQIEQNAGNSLVQDINSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLF GAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKRYQLVSDGGFSAQGVVGQPLN KDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQ IREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVD LPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGR VTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLK PKKALIIILGSIIILGMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDS VKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKT FVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAI ANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHAGT TLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK

The tag type for purification can be determined during the production process based on experimental needs and downstream applications . When designing expression constructs, researchers should consider codon optimization for the host system, incorporation of appropriate signal sequences, and selection of purification tags that minimize interference with functional domains.

How can recombinant wzc protein be utilized in rational Salmonella vaccine development?

The application of recombinant wzc in vaccine development represents a sophisticated approach to creating more effective immunization strategies:

• Salmonella enterica serves as a promising live attenuated carrier for recombinant heterologous antigen presentation, positioning wzc as a potential component in such systems

• Comprehensive understanding of virulence factor molecular mechanisms, including wzc function, enables rational design of improved Salmonella carrier strains

• Modification of the wzc gene can produce attenuated strains with reduced virulence while maintaining immunogenic properties

• Co-expression strategies where heterologous antigens are presented alongside modified wzc may enhance immune responses through targeted delivery to host cells

The implementation of wzc in vaccine development requires careful optimization of attenuation levels to balance reduced pathogenicity with maintained immunogenicity. Researchers should employ molecular techniques to modify wzc expression or function while preserving antigenic epitopes that stimulate robust immune responses.

What methodological approaches are most effective for characterizing wzc kinase activity in vitro?

Characterization of wzc kinase activity requires specialized biochemical techniques:

• Assay composition should include:

  • Purified recombinant wzc protein (0.1-1.0 mg/mL)

  • ATP as a phosphate donor

  • Divalent cations (typically Mg²⁺ or Mn²⁺)

  • Appropriate substrate proteins or synthetic peptides containing tyrosine residues

• Essential control experiments:

  • Heat-inactivated enzyme controls

  • ATP omission controls

  • Addition of tyrosine kinase inhibitors to confirm specificity

• Detection methods:

  • Radioactive assays using ³²P-labeled ATP

  • Phospho-specific antibodies in western blotting

  • Mass spectrometry for identification of phosphorylation sites

When implementing these approaches, researchers should systematically optimize reaction conditions including temperature, pH, incubation time, and substrate concentration to maximize enzyme activity while maintaining specificity.

How does genomic variation of wzc across Salmonella serovars influence protein function and bacterial phenotypes?

Genomic analysis reveals significant variation in wzc genes across Salmonella serovars, with important functional implications:

• Different Salmonella serovars show distinct genomic profiles with varying distributions in different food sources, suggesting niche adaptation that may involve wzc variations

• Analysis of single nucleotide polymorphisms (SNPs) across serovars reveals distinct clusters, potentially affecting wzc functionality

• The presence of wzc in multiple SNP clusters (such as PDS000026869.146 and PDS000004748.44) suggests its conservation across various Salmonella lineages

• The wzc gene expression and function may be differentially regulated in various serovars, contributing to their distinct colonization patterns and virulence profiles

When studying wzc across serovars, researchers should implement comparative genomic approaches to identify sequence variations that might affect protein structure, substrate specificity, or regulatory mechanisms. This comparative approach can reveal evolutionary adaptations that may be exploited for therapeutic intervention.

What is the relationship between wzc function and antimicrobial resistance in Salmonella enterica?

The relationship between wzc and antimicrobial resistance represents an important research area:

• While wzc itself is not classified as an antimicrobial resistance gene (ARG), its function in polysaccharide biosynthesis may indirectly contribute to resistance mechanisms

• Genomic analysis has identified 88 different ARGs across Salmonella isolates, with beta-lactam resistance (n=26) and aminoglycoside resistance (n=25) being most prevalent

• The polysaccharide layer regulated by wzc can function as a diffusion barrier, potentially reducing antibiotic penetration

• Biofilm formation, partially regulated by wzc activity, provides protective environments that enhance bacterial survival during antibiotic exposure

Experimental approaches should include comparative phenotypic analysis between wild-type and wzc-mutant strains under antibiotic challenge, particularly in biofilm growth conditions. Additionally, researchers should investigate potential genetic linkages between wzc variants and ARG clusters to identify co-selection patterns.

What are the critical parameters for assessing wzc-dependent phenotypes in Salmonella research models?

When designing experiments to investigate wzc function, researchers should consider these methodological parameters:

• Generation of wzc knockout mutants through homologous recombination or CRISPR-Cas9 systems, with complementation controls to confirm phenotypic specificity

• Assessment of polysaccharide production using quantitative assays such as Alcian blue staining or uronic acid determination

• Biofilm formation evaluation through crystal violet staining, confocal microscopy with fluorescent stains, or scanning electron microscopy

• Virulence assessment in appropriate infection models with careful documentation of colonization efficiency, dissemination patterns, and host immune responses

Each approach should include appropriate controls, including wild-type strains, complemented mutants, and isogenic mutants affecting related pathways to establish specificity of wzc-dependent effects.

How should researchers approach structural biology studies of wzc to inform functional analyses?

Structural biology approaches provide valuable insights into wzc function:

• Protein preparation considerations:

  • High purity recombinant protein (>85% by SDS-PAGE)

  • Buffer optimization to maintain protein stability and prevent aggregation

  • Analysis of phosphorylation state, as autophosphorylation may affect structural properties

• Structural determination methods:

  • X-ray crystallography for high-resolution static structures

  • Cryo-electron microscopy for visualization of membrane-associated conformations

  • Nuclear magnetic resonance for dynamic structural information

• Computational analyses:

  • Molecular dynamics simulations to predict conformational changes during catalytic cycles

  • Structure-based virtual screening for potential inhibitor discovery

  • Homology modeling to predict structural implications of sequence variations across serovars

These structural insights can directly inform the design of functional studies, identification of critical residues for mutagenesis, and development of specific inhibitors with potential therapeutic applications.

How can wzc be utilized as a target for novel antimicrobial development?

The unique properties of wzc position it as a promising target for antimicrobial development:

• As a bacterial-specific tyrosine kinase with no mammalian homologs, wzc inhibitors may offer high selectivity with minimal host toxicity

• The role of wzc in virulence and biofilm formation suggests that inhibitors could reduce pathogenicity without directly killing bacteria, potentially reducing selection pressure for resistance

• Structure-guided design approaches can leverage the ATP-binding pocket and substrate recognition sites to develop highly specific inhibitors

• Combination approaches targeting wzc alongside conventional antibiotics may enhance efficacy against biofilm-associated infections

Research in this direction should focus on high-throughput screening of chemical libraries, rational design based on structural information, and in vivo validation of candidate molecules in relevant infection models.

What are the emerging technologies for studying wzc-dependent phosphorylation networks in Salmonella?

Advanced technologies for phosphorylation studies include:

• Phosphoproteomic approaches:

  • Phosphopeptide enrichment coupled with mass spectrometry

  • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) for quantitative comparison

  • Targeted selected reaction monitoring (SRM) for focused analysis of specific phosphosites

• High-throughput screening methods:

  • Protein microarrays to identify novel substrates

  • Peptide libraries to define phosphorylation motif preferences

  • Genetic interaction screens to map functional connections

• In vivo phosphorylation monitoring:

  • Genetically encoded biosensors

  • Phospho-specific antibodies for immunofluorescence

  • Proximity labeling approaches to identify spatially restricted interactions

These methodologies can be applied to compare phosphorylation networks between wild-type and wzc mutant strains, identifying both direct substrates and downstream signaling effects that contribute to bacterial phenotypes.