Recombinant Salmonella typhimurium Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview and Biochemical Properties

ArnC (UniProt ID: O52324) is a 327-amino acid membrane-bound protein classified as a type-2 glycosyltransferase (GT-2). It catalyzes the transfer of 4-deoxy-4-formamido-l-arabinose (Ara4FN) from UDP-Ara4FN to undecaprenyl phosphate, a lipid carrier in the inner membrane .

PropertyDetail
SourceSalmonella typhimurium
Expression HostE. coli
TagN-terminal His-tag (for purification)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Protein LengthFull-length (1–327 aa)
Sequence HighlightsContains DxD motif (divalent cation-binding site) and transmembrane helices

Functional Role in Polymyxin Resistance

ArnC operates in the arnBCDTEF operon, modifying lipid-A with Ara4FN to reduce polymyxin binding .

Pathway Overview

  1. pmrE/ugd Loci: Synthesize UDP-Ara4FN via UDP-glucose 6-dehydrogenase (PmrE/Ugd).

  2. ArnC Activity: Transfers Ara4FN to undecaprenyl phosphate.

  3. ArnD: De-phosphorylates the product to yield UndP-Ara4FN, which is incorporated into LPS .

Clinical Relevance

  • Antimicrobial Resistance: Ara4FN-modified LPS reduces polymyxin efficacy in Salmonella and E. coli .

  • Epidemiological Impact: Linked to multidrug-resistant Salmonella Typhimurium strains in livestock and poultry .

Research Applications and Therapeutic Potential

ArnC is a target for developing inhibitors to restore polymyxin susceptibility.

Key Research Findings

  1. Catalytic Mechanism:

    • DxD Motif: Critical for divalent cation binding (e.g., Mg²⁺/Ca²⁺) .

    • UDP Dependency: Conformational changes in IH1/IH2 suggest a nucleotide-sensing mechanism .

  2. Structural Homologs:

    • GtrB (Synechocystis): Shares TM topology but lacks defined periplasmic loops .

    • DPMS (Pyrococcus furiosus): Diverges in IH organization despite conserved GT-2 folds .

Production and Handling Guidelines

Recombinant ArnC is lyophilized and requires careful reconstitution .

ParameterRecommendation
ReconstitutionUse sterile deionized water (0.1–1.0 mg/mL final concentration).
Glycerol Addition50% final concentration for long-term storage at -20°C/-80°C .
Freeze-Thaw CyclesAvoid repeated cycles; store in aliquots .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
arnC; pbgP2; pmrF; STM2298; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Polymyxin resistance protein PmrF; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Target Names
arnC
Target Protein Sequence
MFDAAPIKKVSVVIPVYNEQESLPELIRRTTTACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTPFTEESHQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides. Its role in pathogenesis is significant, as it confers resistance to antimicrobial peptides within macrophages and other infection sites.

Database Links

KEGG: stm:STM2298

STRING: 99287.STM2298

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) and what is its role in Salmonella typhimurium?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, encoded by the arnC gene, is a critical enzyme that catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) from UDP to undecaprenyl phosphate in Salmonella typhimurium and related Gram-negative bacteria . This enzymatic reaction represents a key step in the modification of lipid A, which is the most conserved component of bacterial lipopolysaccharide (LPS) and constitutes the outer membrane of Gram-negative bacteria. The modified arabinose that gets attached to lipid A plays a crucial role in conferring resistance to polymyxins and various cationic antimicrobial peptides, which are important components of host innate immune defenses . This modification alters the net negative charge of the bacterial cell surface, reducing the electrostatic interaction with positively charged antimicrobial peptides and thereby enhancing bacterial survival during host infection.

In Salmonella typhimurium specifically, arnC functions within the context of a bacterium that has gained significant attention for its potential applications in cancer therapy and as a delivery vector for therapeutic molecules . The functionality of arnC must be considered within this broader context of Salmonella biology, where lipid A structure influences both pathogenicity and the bacterium's interaction with host immune systems. Understanding arnC's role provides critical insights into bacterial adaptive mechanisms and potential targets for antibacterial therapies or bioengineering approaches for therapeutic applications.

How does lipid A modification via arnC affect host immune recognition of Salmonella typhimurium?

The modification of lipid A through arnC-mediated addition of 4-deoxy-4-formamido-L-arabinose significantly alters how host immune receptors recognize Salmonella typhimurium. The lipid A component of LPS is specifically recognized by host pattern recognition receptors, including Toll-like receptor 4 (TLR-4) extracellularly and caspase-11 intracellularly, which are crucial for activating innate immune responses against bacterial pathogens . The structure-activity relationship of lipid A, particularly the number, length, and symmetry of acyl chains, governs its immunostimulatory potential, with the arnC-mediated arabinose modification creating additional structural changes that affect this recognition.

Research has demonstrated that modified lipid A structures can differentially activate host immune responses, with some modifications resulting in antagonism or poor activation of TLR-4 and caspase-11 signaling pathways . For instance, penta- and tetra-acylated lipid A variants have shown reduced ability to stimulate these pathways compared to the hexa-acylated forms typically found in wild-type Enterobacteriaceae. This immunomodulatory effect was observed in clinical trials with VNP20009, a Salmonella strain that predominantly synthesizes penta-acylated lipid A due to specific mutations, which may partly explain its limited efficacy in human studies . Understanding these immunological interactions is essential for designing Salmonella-based therapeutic agents with optimal immunostimulatory properties.

What techniques are most effective for measuring arnC expression and activity in Salmonella typhimurium?

Several complementary techniques can be employed to comprehensively measure arnC expression and activity in Salmonella typhimurium. For gene expression analysis, quantitative reverse transcription PCR (RT-qPCR) remains the gold standard, allowing precise quantification of arnC mRNA levels under various experimental conditions. This can be supplemented with RNA-Seq for a genome-wide perspective on how arnC expression correlates with other genes in the lipid A modification pathway. Protein-level expression can be assessed using Western blotting with specific antibodies against the ArnC protein, while more quantitative approaches include mass spectrometry-based proteomics.

For functional assessment of ArnC enzyme activity, biochemical assays measuring the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate provide direct evidence of enzymatic function. This typically involves radioactively labeled substrates and thin-layer chromatography or HPLC to separate and quantify reaction products. The biological consequences of ArnC activity can be evaluated through antimicrobial peptide resistance assays, particularly determining the minimum inhibitory concentration (MIC) of polymyxins against wild-type versus arnC-modified Salmonella strains. Mass spectrometry analysis of lipid A structures extracted from bacterial cells offers definitive evidence of the arabinose modification, allowing researchers to directly correlate structural changes with genetic modifications.

How can researchers generate and validate recombinant Salmonella typhimurium strains with modified arnC for research purposes?

Generating recombinant Salmonella typhimurium strains with modified arnC requires strategic molecular genetic approaches tailored to the specific research objectives. The lambda Red recombineering system has proven particularly effective for creating precise genetic modifications in Salmonella, allowing for targeted gene deletions, insertions, or point mutations in the arnC gene. This approach typically employs PCR-generated DNA fragments containing antibiotic resistance cassettes flanked by homology regions targeting the arnC locus, followed by electroporation into Salmonella cells expressing the lambda Red proteins. For more subtle modifications, like specific amino acid substitutions that might affect enzyme activity without eliminating it entirely, CRISPR-Cas9 gene editing offers advantages through its ability to introduce precise changes without leaving selection markers.

Validation of successfully modified strains requires a multi-faceted approach beginning with PCR verification of the intended genetic changes, followed by sequencing to confirm the exact modifications. Expression analysis using RT-qPCR or RNA-Seq confirms whether the modifications have affected arnC transcription as expected. Protein-level validation through Western blotting or mass spectrometry verifies that the modified gene produces the expected protein variant. Functional validation is crucial and should include lipid A structural analysis using mass spectrometry to directly observe changes in arabinose modification patterns, complemented by polymyxin resistance assays to assess the biological impact of these structural alterations.

When working with attenuated Salmonella strains for potential therapeutic applications, researchers should consider generating modifications in background strains already proven useful for such purposes, such as the UK-1 strain which has demonstrated superior anti-tumor properties compared to strains like LT-2 . The introduction of auxotrophic mutations (such as ΔaroA and ΔpurM) alongside arnC modifications may enhance the strain's safety profile while maintaining tumor-targeting ability . Careful phenotypic characterization of the recombinant strains, including growth rates, motility, virulence in appropriate models, and tumor-targeting efficiency, ensures that the arnC modifications do not unexpectedly alter other important characteristics of the bacterium.

How does arnC-mediated lipid A modification influence Salmonella typhimurium's potential as an anti-tumor agent?

The arnC-mediated lipid A modification significantly impacts Salmonella typhimurium's utility as an anti-tumor agent through several interconnected mechanisms. Lipid A structure directly influences the immunostimulatory properties of Salmonella, with modifications affecting how the bacterium interacts with the host immune system, particularly in the tumor microenvironment . Research has demonstrated that optimally modified lipid A can enhance the bacterium's ability to stimulate anti-tumor immune responses, potentially converting "cold" tumors unresponsive to immunotherapy into "hot" immunologically active tumors. The strain D2, which was developed through modification of lipid A structure from an auxotrophic UK-1 strain (D1), demonstrated enhanced immunostimulatory activity compared to its parent strain, highlighting the importance of lipid A configuration in anti-tumor applications .

The relationship between polymyxin resistance (conferred by arnC activity) and anti-tumor efficacy presents an interesting research paradox. While arabinose modification enhances bacterial survival against host antimicrobial peptides, potentially improving tumor colonization, excessive resistance might reduce the immunostimulatory properties needed for optimal anti-tumor effects. Studies comparing different Salmonella strains (14028, SL1344, UK-1, and LT-2) for motility, virulence, and anti-tumor efficacy demonstrated that UK-1 exhibited superior phenotypes, suggesting that the baseline lipid A structure and modification patterns in this strain contribute to its enhanced anti-tumor properties . When UK-1 was further engineered to deliver anti-tumor molecules like endostatin (an angiogenesis inhibitor) and TRAIL (an apoptosis inducer), the resulting therapy significantly suppressed tumor growth and prolonged survival in mouse models of colon carcinoma and melanoma compared to controls .

A critical consideration in optimizing arnC-mediated modifications for anti-tumor applications involves balancing bacterial attenuation for safety with maintained tumor-targeting ability. The introduction of auxotrophic mutations (ΔaroA and ΔpurM) in Salmonella strains reduces virulence in normal tissues while preserving tumor colonization capabilities, addressing a key challenge in bacterial cancer therapy . Understanding the precise contribution of arnC to this balance requires sophisticated experimental approaches that can decouple its effects on bacterial survival from its influences on immunostimulation, factors that together determine therapeutic efficacy in complex tumor microenvironments.

What are the implications of arnC mutations on bacterial resistance to antimicrobial peptides and potential therapeutic applications?

Mutations in the arnC gene have profound implications for Salmonella typhimurium's resistance profile against cationic antimicrobial peptides, with direct consequences for potential therapeutic applications. The enzyme encoded by arnC catalyzes a critical step in lipid A modification that reduces the negative charge of the bacterial outer membrane, thereby decreasing the electrostatic attraction between the membrane and positively charged antimicrobial peptides . Consequently, arnC mutations that reduce or eliminate this modification typically result in increased susceptibility to polymyxins and host-derived antimicrobial peptides, potentially limiting bacterial survival in host tissues. This susceptibility pattern can be quantified through minimum inhibitory concentration (MIC) determinations, which typically show significant decreases in polymyxin MICs for arnC mutants compared to wild-type strains.

From a therapeutic design perspective, controlled modulation of arnC expression might offer advantages over complete gene deletion. Inducible or tumor-specific expression systems could potentially allow for context-dependent regulation of lipid A modification, enhancing bacterial survival during initial tumor colonization while maximizing immunostimulatory properties once established in the tumor microenvironment. Engineering approaches that fine-tune rather than eliminate arnC function might therefore prove valuable in optimizing Salmonella-based therapeutic agents, particularly when combined with other modifications such as the expression of anti-tumor molecules like endostatin and TRAIL, which have shown promising results in preclinical models .

What statistical approaches are appropriate for analyzing data from arnC modification studies?

For more complex experimental designs investigating the interactions between arnC modifications and other factors (such as growth conditions or additional genetic modifications), factorial ANOVA or mixed-effects models offer appropriate analytical frameworks. These approaches allow researchers to disentangle main effects from interaction effects, providing insights into how arnC modifications might function differently across varying contexts. When analyzing time-course data, such as bacterial growth or gene expression over time, repeated measures ANOVA or longitudinal data analysis techniques account for the non-independence of observations from the same experimental units over time.

Non-parametric alternatives should be considered when data violate the assumptions of parametric tests. For instance, the Kruskal-Wallis test can replace one-way ANOVA when normality assumptions are not met, while the Friedman test provides a non-parametric alternative for repeated measures designs. For survival data from animal experiments testing Salmonella-based therapies, Kaplan-Meier survival analysis with log-rank tests offers appropriate statistical treatment. Regardless of the specific test chosen, researchers should report effect sizes alongside p-values to indicate the magnitude and biological significance of observed differences, and should consider multiple testing corrections (such as Bonferroni or False Discovery Rate adjustments) when conducting numerous statistical comparisons.

How can researchers effectively analyze the structural impact of arnC modifications on lipid A using mass spectrometry data?

Mass spectrometry analysis of lipid A structures provides rich datasets that require specialized analytical approaches to fully characterize the impact of arnC modifications. Matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry represents a common first-line approach, generating spectra with mass-to-charge (m/z) peaks corresponding to different lipid A species. Researchers should begin analysis by identifying characteristic peaks associated with non-modified lipid A and those representing arabinose-modified variants, with the latter typically showing mass shifts of approximately +131 Da corresponding to the 4-deoxy-4-formamido-L-arabinose moiety. Quantitative comparisons between wild-type and arnC-modified strains can be performed by calculating the relative abundances of modified versus unmodified peaks, providing insights into the efficiency of the modification process.

For more detailed structural characterization, tandem mass spectrometry (MS/MS) is invaluable, allowing fragmentation of specific lipid A species to determine the precise location of modifications. This approach can distinguish between various modified forms that might have similar masses but different structures, such as differentiating between arabinose addition at different positions on the lipid A molecule. Computational tools for spectral matching and database searching facilitate identification of known structures, while de novo interpretation approaches may be necessary for novel modifications. When comparing multiple samples or conditions, multivariate statistical methods such as principal component analysis (PCA) or hierarchical clustering can identify patterns and groupings in the data that might not be apparent from visual inspection of individual spectra.

Integration of mass spectrometry data with biological assays provides the most comprehensive understanding of arnC's impact. Correlation analyses between the abundance of specific modified lipid A species and phenotypic measurements (such as polymyxin MICs or immunostimulatory capacity) can reveal structure-function relationships. Statistical approaches for such correlations include Pearson or Spearman correlation coefficients, depending on whether the relationships appear linear or non-linear. For visualization, heat maps combining structural data with phenotypic measurements offer intuitive representations of complex datasets, potentially revealing patterns that connect specific structural features to functional outcomes in different experimental contexts.

What are the current limitations in studying recombinant Salmonella typhimurium with modified arnC, and how might these be addressed?

Research on recombinant Salmonella typhimurium with modified arnC faces several significant limitations that require innovative approaches to overcome. One fundamental challenge involves the complex regulatory networks governing lipid A modification, where arnC functions as part of a larger operon responsive to environmental signals. This complexity makes it difficult to study arnC in isolation, as modifications may trigger compensatory changes in related pathways. Advanced approaches such as RNA-Seq combined with network analysis can help map these regulatory interactions, while CRISPR interference (CRISPRi) techniques offer possibilities for targeted, tunable repression of specific genes without permanent genetic modifications, potentially allowing more nuanced manipulation of the system.

Another major limitation concerns the translation of findings from laboratory models to clinical applications, particularly for anti-tumor therapies. Mouse models, while valuable, do not fully recapitulate human tumor microenvironments or immune responses to Salmonella. Studies comparing different Salmonella strains have shown varying phenotypes in terms of motility, virulence, and anti-tumor efficacy, with strains like UK-1 demonstrating superior characteristics compared to others such as LT-2 . These differences highlight the importance of strain selection and the need for models that better reflect human physiology. Humanized mouse models with reconstituted human immune systems represent one promising approach, while organ-on-chip technologies could provide controlled microenvironments for studying Salmonella-tumor interactions without the complexities of whole-animal systems.

Technical challenges in structural analysis also limit comprehensive understanding of arnC's impact. While mass spectrometry provides valuable insights into lipid A modifications, sample preparation inconsistencies and the complexity of bacterial membrane extracts can complicate interpretation. Emerging technologies combining imaging mass spectrometry with high-resolution microscopy may enable spatial mapping of lipid A modifications within bacterial populations or during host interaction, providing contextual information currently missing from bulk analyses. Additionally, the development of synthetic biology approaches for creating libraries of arnC variants with precisely controlled expression levels could enable more systematic exploration of the relationship between modification levels and phenotypic outcomes, addressing current difficulties in fine-tuning this system for optimal therapeutic applications.

What emerging research directions could enhance our understanding of arnC function in Salmonella typhimurium?

Several promising research directions are poised to deepen our understanding of arnC function in Salmonella typhimurium and expand its applications. Single-cell technologies represent a particularly exciting frontier, as they can reveal heterogeneity in lipid A modification within bacterial populations that bulk analyses might miss. Techniques such as single-cell RNA-Seq could identify subpopulations with distinct arnC expression patterns, while mass cytometry (CyTOF) incorporating metal-labeled antibodies against specific lipid A structures could quantify modification patterns at the individual cell level. This single-cell perspective may prove especially valuable for understanding how heterogeneous bacterial populations interact with complex tumor microenvironments, potentially explaining variability in therapeutic outcomes.

The integration of structural biology approaches offers another promising direction, as the three-dimensional structure of ArnC remains incompletely characterized. Advanced techniques like cryo-electron microscopy could reveal the precise molecular architecture of the enzyme, while computational approaches such as molecular dynamics simulations might elucidate the mechanistic details of the arabinose transfer reaction. Structure-guided protein engineering could then potentially create modified versions of ArnC with altered substrate specificity or activity levels, expanding the toolkit for bacterial engineering. These structural insights, combined with high-throughput screening approaches, might identify small molecule modulators of ArnC activity that could serve as research tools or potential adjuvants for antimicrobial therapy.

Perhaps the most transformative emerging direction involves synthetic biology approaches to repurpose the arnC pathway for novel functions. The enzymatic machinery for lipid A modification could potentially be engineered to incorporate non-natural sugars or other functional groups onto the bacterial surface, creating opportunities for applications beyond antimicrobial resistance. For instance, the incorporation of immunomodulatory molecules or targeting ligands could enhance the precision and efficacy of Salmonella-based cancer therapies. Systems biology approaches integrating genome-scale metabolic models with transcriptomic and proteomic data could guide these engineering efforts by predicting the system-wide effects of pathway modifications. As researchers better understand the regulatory networks controlling arnC expression, the development of synthetic circuits allowing spatiotemporal control of lipid A modification could enable context-dependent bacterial behaviors optimized for specific therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.